DCUN1D1 Antibody

Images

 
Western Blot: DCUN1D1 Antibody [NBP1-85275] - Analysis in human cell line A-431.
Immunocytochemistry/ Immunofluorescence: DCUN1D1 Antibody [NBP1-85275] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: DCUN1D1 Antibody [NBP1-85275] - Staining of human kidney shows moderate cytoplasmic positivity in tubule cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DCUN1D1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DCUN1D1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DCUN1D1 Protein (NBP1-85275PEP)
Publications
Read Publication using
NBP1-85275 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24874471).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DCUN1D1 Antibody

  • DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae)
  • DCN1-like protein 1
  • DCUN1L1DCUN1 domain-containing protein 1
  • Defective in cullin neddylation protein 1-like protein 1
  • RP42 homolog
  • RP42Squamous cell carcinoma-related oncogene
  • SCCROSCRO
  • Tes3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00143384-B01P
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB120-1868
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP2-37523
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-55035
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-77306
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-46403
Species: Hu
Applications: IHC
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-47485
Species: Hu
Applications: WB, IHC, IHC-P
MAB9181
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85275
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DCUN1D1 Antibody (NBP1-85275)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for DCUN1D1 Antibody (NBP1-85275) (0)

There are no reviews for DCUN1D1 Antibody (NBP1-85275). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DCUN1D1 Antibody (NBP1-85275) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DCUN1D1 Products

Bioinformatics Tool for DCUN1D1 Antibody (NBP1-85275)

Discover related pathways, diseases and genes to DCUN1D1 Antibody (NBP1-85275). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DCUN1D1 Antibody (NBP1-85275)

Discover more about diseases related to DCUN1D1 Antibody (NBP1-85275).
 

Pathways for DCUN1D1 Antibody (NBP1-85275)

View related products by pathway.

PTMs for DCUN1D1 Antibody (NBP1-85275)

Learn more about PTMs related to DCUN1D1 Antibody (NBP1-85275).

Blogs on DCUN1D1

There are no specific blogs for DCUN1D1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DCUN1D1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DCUN1D1