DCUN1D1 Antibody - BSA Free

Western Blot: DCUN1D1 Antibody [NBP1-85275] - Analysis in control (vector only transfected HEK293T lysate) and DCUN1D1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: DCUN1D1 Antibody [NBP1-85275] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: DCUN1D1 Antibody [NBP1-85275] - Staining of human kidney shows moderate cytoplasmic positivity in tubule cells.

Western Blot: DCUN1D1 Antibody [NBP1-85275] - Analysis in human cell line A-431.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DCUN1D1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DCUN1D1 Antibody - BSA Free (NBP1-85275) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-DCUN1D1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNR
• Predicted Species: Mouse (98%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DCUN1D1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DCUN1D1 Protein (NBP1-85275PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24874471).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DCUN1D1 Antibody - BSA Free

• DCN1
• DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae)
• DCN1-like protein 1
• DCNL1
• DCUN1D1
• DCUN1L1
• DCUN1L1DCUN1 domain-containing protein 1
• Defective in cullin neddylation protein 1-like protein 1
• RP42 homolog
• RP42
• RP42Squamous cell carcinoma-related oncogene
• SCCRO
• SCCROSCRO
• Tes3

Background

DCUN1D1 may contribute to neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-typecomplexes activity

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DCUN1D1 Antibody (NBP1-85275)(1)

Publication using NBP1-85275

• Chen Y, McGee J, Chen X et al. Identification of Druggable Cancer Driver Genes Amplified across TCGA Datasets. PLoS One 2014-01-01 [PMID: 24874471] (WB, Human)

Bioinformatics

• Gene Symbol: DCUN1D1