DCUN1D1 Antibody


Western Blot: DCUN1D1 Antibody [NBP1-85275] - Analysis in human cell line A-431.
Immunocytochemistry/ Immunofluorescence: DCUN1D1 Antibody [NBP1-85275] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: DCUN1D1 Antibody [NBP1-85275] - Staining of human kidney shows moderate cytoplasmic positivity in tubule cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

DCUN1D1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNR
Specificity of human DCUN1D1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DCUN1D1 Protein (NBP1-85275PEP)
Read Publication using
NBP1-85275 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24874471).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DCUN1D1 Antibody

  • DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae)
  • DCN1-like protein 1
  • DCUN1L1DCUN1 domain-containing protein 1
  • Defective in cullin neddylation protein 1-like protein 1
  • RP42 homolog
  • RP42Squamous cell carcinoma-related oncogene
  • Tes3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DCUN1D1 Antibody (NBP1-85275)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for DCUN1D1 Antibody (NBP1-85275) (0)

There are no reviews for DCUN1D1 Antibody (NBP1-85275). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DCUN1D1 Antibody (NBP1-85275) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DCUN1D1 Products

Bioinformatics Tool for DCUN1D1 Antibody (NBP1-85275)

Discover related pathways, diseases and genes to DCUN1D1 Antibody (NBP1-85275). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DCUN1D1 Antibody (NBP1-85275)

Discover more about diseases related to DCUN1D1 Antibody (NBP1-85275).

Pathways for DCUN1D1 Antibody (NBP1-85275)

View related products by pathway.

PTMs for DCUN1D1 Antibody (NBP1-85275)

Learn more about PTMs related to DCUN1D1 Antibody (NBP1-85275).

Blogs on DCUN1D1

There are no specific blogs for DCUN1D1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DCUN1D1 Antibody and receive a gift card or discount.


Gene Symbol DCUN1D1