DCPS Antibody - BSA Free

Western Blot: DCPS Antibody [NBP1-81749] - Analysis in EFO-21 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-DCPS antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Immunocytochemistry/Immunofluorescence: DCPS Antibody [NBP1-81749] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: DCPS Antibody [NBP1-81749] - Staining of human liver shows strong nuclear positivity in hepatocytes.

Western Blot: DCPS Antibody [NBP1-81749] - Analysis in human cell line PC-3.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DCPS Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DCPS Antibody - BSA Free (NBP1-81749) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-DCPS Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QLGKRKRELDVEEAHAASTEEKEAGVGNGTCAPVRLPFSGFRLQKVLRESARDKIIFLHGKVNEASGDGDGEDAVVILEKTPFQVEQVAQLLTGSPE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DCPS
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB, ICC/IF reported in scientific literature (PMID: 25712129). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DCPS Protein (NBP1-81749PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (82%). Human reactivity reported in scientific literature (PMID: 25712129).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DCPS Antibody - BSA Free

• DCS1
• DCS-1
• decapping enzyme, scavenger
• EC 3.-
• heat shock-like protein 1
• HINT5
• HINT-5homolog of C. elegans 7meGMP-directed hydrolase dcs-1
• Hint-related 7meGMP-directed hydrolase
• Histidine triad protein member 5
• HSL1
• HSPC015
• mRNA decapping enzyme
• scavenger mRNA-decapping enzyme DcpS

Background

Necessary for the complete degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Removes the 7-methyl guanine cap structure from mRNA fragments shorter than 10 nucleotides that are produced by 3'->5' exosome-mediated mRNA decay. Releases m7GMP. Can also degrade m7GDP to m7GMP. Has no activity towards mRNA molecules longer than 25 nucleotides

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DCPS Antibody (NBP1-81749)(1)

Publication using NBP1-81749

• Ng CK, Shboul M, Taverniti V et al. Loss of the scavenger mRNA decapping enzyme DCPS causes syndromic intellectual disability with neuromuscular defects. Hum Mol Genet 2015-06-01 [PMID: 25712129] (WB, ICC/IF, Human)

Bioinformatics

• Gene Symbol: DCPS