DCP2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: DCP2 Antibody [NBP2-56996] - Staining of human cell line MCF7 shows localization to nucleoplasm, cell junctions & cytoplasmic bodies. Antibody staining is shown in green.

ChIP-Exo-Seq composite graph for Anti-DCP2 (NBP2-56996) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu
• Applications: ICC/IF, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DCP2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DCP2 Antibody - BSA Free (NBP2-56996) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GLQPAKQQNSLMKCEKKLHPRKLQDNFETDAVYDLPSSSEDQLLEHAEGQPVACNGHCKFPFSSRAFLSFKFDHNAIMKILDL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DCP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DCP2 Recombinant Protein Antigen (NBP2-56996PEP)

Reactivity Notes

Mouse 82%, Rat 83%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DCP2 Antibody - BSA Free

• DCP2 decapping enzyme homolog (S. cerevisiae)
• EC 3.-
• FLJ33245
• hDpc
• mRNA-decapping enzyme 2
• nudix (nucleoside diphosphate linked moiety X)-type motif 20
• Nudix motif 20
• NUDT20Nucleoside diphosphate-linked moiety X motif 20

Background

DCP2 is a key component of an mRNA-decapping complex required for removal of the 5-prime cap from mRNA prior to its degradation from the 5-prime end (Fenger-Gron et al., 2005 [PubMed 16364915]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DCP2