DCC Recombinant Protein Antigen

Images

 
There are currently no images for DCC Recombinant Protein Antigen (NBP2-49606PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DCC Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DCC.

Source: E. coli

Amino Acid Sequence: ACVRPTHPLRSFANPLLPPPMSAIEPKVPYTPLLSQPGPTLPKTHVKTASLGLAGKARSPLLPVSVPTAPEVSEESHKPTEDSANVYEQDDLSEQMAS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DCC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49606.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DCC Recombinant Protein Antigen

  • Colorectal cancer suppressor
  • CRC18
  • CRCR1
  • DCC
  • deleted in colorectal cancer protein
  • deleted in colorectal carcinoma
  • IGDCC1colorectal tumor suppressor
  • Immunoglobulin superfamily DCC subclass member 1
  • immunoglobulin superfamily, DCC subclass, member 1
  • netrin receptor DCC
  • Tumor suppressor protein DCC

Background

Invasive, metastatic colon cancer arises from pre-existing adenomas in both familial and sporadic cases and is characterized by the presence of multiple chromosomal alterations. In the progression from intramucosal carcinoma to invasive carcinoma, allelic loss on the long arm of chromosome 18 is frequently observed. Recently, a gene on 18q21.3 termed DCC, for deleted in colorectal carcinoma, has been isolated and shown to be deleted or mutated in both sporadic and inherited colon carcinoma whereas normal colonic tissue retained and expressed the gene. Furthermore, loss of DCC expression appears to accompany progression of adenomas to metastatic carcinoma. The inactivation of DCC suggests that it is a tumor suppressor gene. A functional role for DCC as a tumor suppressor gene is indicated by experiments demonstrating that introduction of a normal chromosome 18 into the human colon tumor cell lines COKFu or SW480.7 lacking DCC suppresses tumorigenicity. Analysis of the amino acid sequence deduced from cDNA clones indicates that DCC is a transmembrane glycoprotein consisting of 1447 amino acids with an extracellular domain having extensive similarity to neural cell adhesion molecules (NCAM), a single transmembrane segment, and a unique cytoplasmic domain. The high degree of similarity to NCAMs suggests that DCC is involved in cell-cell interactions essential to the differentiated state of the colonic epithelium. DCC expression has been observed in all tissues examined except liver with the highest level of expression in brain tissue. Alterations in DCC expression have also been observed in pancreatic adenocarcinoma and esophogeal carcinoma. However, DCC mRNA is expressed at very low levels, requiring reverse transcription followed by PCR amplification for unambiguous detection.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
1109-N1
Species: Mu
Applications: Bind
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF4885
Species: Mu
Applications: IP, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
AF2097
Species: Hu
Applications: ChIP, ICC, WB
NBP2-42864
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
AF1079
Species: Hu, Mu
Applications: Block, IHC, Simple Western, WB
NBP1-85885
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF3797
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
MAB1005
Species: Hu
Applications: IHC, WB
NB100-621
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP2-67381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, KO, WB

Publications for DCC Recombinant Protein Antigen (NBP2-49606PEP) (0)

There are no publications for DCC Recombinant Protein Antigen (NBP2-49606PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DCC Recombinant Protein Antigen (NBP2-49606PEP) (0)

There are no reviews for DCC Recombinant Protein Antigen (NBP2-49606PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DCC Recombinant Protein Antigen (NBP2-49606PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DCC Products

Research Areas for DCC Recombinant Protein Antigen (NBP2-49606PEP)

Find related products by research area.

Blogs on DCC

There are no specific blogs for DCC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DCC Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DCC