DC-SIGNR/CD299/CLEC4M Antibody - BSA Free

Western Blot: DC-SIGNR/CD299/CLEC4M Antibody [NBP1-59182] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml

Immunohistochemistry-Paraffin: DC-SIGNR/CD299/CLEC4M Antibody [NBP1-59182] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

DC-SIGNR/CD299/CLEC4M Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to CLEC4M(C-type lectin domain family 4, member M) The peptide sequence was selected from the N terminal of CLEC4M. Peptide sequence LVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAV. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLEC4M
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for DC-SIGNR/CD299/CLEC4M Antibody - BSA Free

• CD209L
• CD209L1
• CD209Ldendritic cell-specific ICAM-3-grabbing nonintegrin 2
• CD299 antigenMGC129964
• CD299
• CLEC4M
• C-type lectin domain family 4, member M
• DC-SIGN2
• DC-SIGN2CD209 antigen-like protein 1
• DCSIGNR
• DC-SIGNR
• DC-SIGNRDC-SIGN-related protein
• DCSIGNRMGC47866
• Dendritic cell-specific ICAM-3-grabbing non-integrin 2
• HP10347
• liver/lymph node-specific ICAM-3 grabbing non-integrin
• Liver/lymph node-specific ICAM-3-grabbing non-integrin
• LSIGN
• L-SIGN
• LSIGNC-type lectin domain family 4 member M
• mannose binding C-type lectin DC-SIGNR

Background

CLEC4M is a type II integral membrane protein that is 77% identical to CD209 antigen, a HIV gp120-binding protein. This protein, like CD209, efficiently binds both intercellular adhesion molecule 3 (ICAM3) and HIV-1 gp120, and enhances HIV-1 infection of T cells.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.This gene encodes a type II integral membrane protein that is 77% identical to CD209 antigen, a HIV gp120-binding protein. This protein, like CD209, efficiently binds both intercellular adhesion molecule 3 (ICAM3) and HIV-1 gp120, and enhances HIV-1 infection of T cells. This gene is mapped to 19p13.3, in a cluster with the CD209 and CD23/FCER2 genes. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DC-SIGNR/CD299/CLEC4M Antibody (NBP1-59182)(1)

Publication using NBP1-59182

• Rydz N, Swystun LL, Notley C et al. The C-type lectin receptor CLEC4M binds, internalizes and clears von Willebrand factor and contributes to the variation in plasma von Willebrand factor levels Blood 2013-03-25 [PMID: 23529928]

Bioinformatics

• Gene Symbol: CLEC4M
• Uniprot:
  • Q9H2X3()