DC-SIGNR/CD299/CLEC4M Antibody - BSA Free

Western Blot: CLEC4M Antibody [NBP1-59181] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

DC-SIGNR/CD299/CLEC4M Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to CLEC4M(C-type lectin domain family 4, member M) The peptide sequence was selected from the n terminal of CLEC4M. Peptide sequence MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGA. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLEC4M
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for DC-SIGNR/CD299/CLEC4M Antibody - BSA Free

• CD209L
• CD209L1
• CD209Ldendritic cell-specific ICAM-3-grabbing nonintegrin 2
• CD299 antigenMGC129964
• CD299
• CLEC4M
• C-type lectin domain family 4, member M
• DC-SIGN2
• DC-SIGN2CD209 antigen-like protein 1
• DCSIGNR
• DC-SIGNR
• DC-SIGNRDC-SIGN-related protein
• DCSIGNRMGC47866
• Dendritic cell-specific ICAM-3-grabbing non-integrin 2
• HP10347
• liver/lymph node-specific ICAM-3 grabbing non-integrin
• Liver/lymph node-specific ICAM-3-grabbing non-integrin
• LSIGN
• L-SIGN
• LSIGNC-type lectin domain family 4 member M
• mannose binding C-type lectin DC-SIGNR

Background

CLEC4M is a transmembrane receptor and is often referred to as L-SIGN because of its expression in the endothelial cells of the lymph nodes and liver. It is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses, with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are common and have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene (GeneID 30835; often referred to as DC-SIGN or CD209). DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants.This gene encodes a type II integral membrane protein that is 77% identical to CD209 antigen, a HIV gp120-binding protein. This protein, like CD209, efficiently binds both intercellular adhesion molecule 3 (ICAM3) and HIV-1 gp120, and enhances HIV-1 infection of T cells. This gene is mapped to 19p13.3, in a cluster with the CD209 and CD23/FCER2 genes. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CLEC4M
• Uniprot:
  • Q9H2X3()