DBPA Antibody (4D9)

Images

 
Western Blot: DBPA Antibody (4D9) [H00008531-M02] - Analysis of CSDA expression in transfected 293T cell line by CSDA monoclonal antibody (M02), clone 4D9.Lane 1: CSDA transfected lysate(40.1 KDa).Lane 2: ...read more
Immunohistochemistry-Paraffin: DBPA Antibody (4D9) [H00008531-M02] - Analysis of monoclonal antibody to CSDA on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.
Sandwich ELISA: DBPA Antibody (4D9) [H00008531-M02] - Detection limit for recombinant GST tagged CSDA is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
4D9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DBPA Antibody (4D9) Summary

Immunogen
CSDA (NP_003642 241 a.a. - 330 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYR
Specificity
CSDA - cold shock domain protein A
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CSDA
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DBPA Antibody (4D9)

  • cold shock domain protein A
  • Cold shock domain-containing protein A
  • cold-shock domain protein A
  • CSDA1
  • dbpA
  • DBPAcold-shock domain containing A1
  • DNA-binding protein A
  • Single-strand DNA-binding protein NF-GMB
  • ZO-1-associated nucleic acid-binding protein
  • ZONAB

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97572
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NB100-74592
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
H00051380-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-88606
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB120-11197
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
NBP2-19422
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF4986
Species: Hu
Applications: WB
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-87839
Species: Hu
Applications: IHC, IHC-P
NBP2-53384
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008531-M02
Species: Hu
Applications: WB, ELISA, IHC-P

Publications for DBPA Antibody (H00008531-M02) (0)

There are no publications for DBPA Antibody (H00008531-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DBPA Antibody (H00008531-M02) (0)

There are no reviews for DBPA Antibody (H00008531-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DBPA Antibody (H00008531-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DBPA Products

Bioinformatics Tool for DBPA Antibody (H00008531-M02)

Discover related pathways, diseases and genes to DBPA Antibody (H00008531-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DBPA Antibody (H00008531-M02)

Discover more about diseases related to DBPA Antibody (H00008531-M02).
 

Pathways for DBPA Antibody (H00008531-M02)

View related products by pathway.

PTMs for DBPA Antibody (H00008531-M02)

Learn more about PTMs related to DBPA Antibody (H00008531-M02).

Blogs on DBPA

There are no specific blogs for DBPA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DBPA Antibody (4D9) and receive a gift card or discount.

Bioinformatics

Gene Symbol CSDA
Entrez
OMIM
Uniprot