DBPA Antibody (4D9) - Azide and BSA Free

Western Blot: DBPA Antibody (4D9) [H00008531-M02] - Analysis of CSDA expression in transfected 293T cell line by CSDA monoclonal antibody (M02), clone 4D9.Lane 1: CSDA transfected lysate(40.1 KDa).Lane 2: Non-transfected lysate.

Immunohistochemistry-Paraffin: DBPA Antibody (4D9) [H00008531-M02] - Analysis of monoclonal antibody to CSDA on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.

Sandwich ELISA: DBPA Antibody (4D9) [H00008531-M02] - Detection limit for recombinant GST tagged CSDA is approximately 0.3ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 4D9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

DBPA Antibody (4D9) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CSDA (NP_003642, 241 a.a. ~ 330 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYR
• Specificity: CSDA - cold shock domain protein A
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: YBX3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot
• Application Notes: Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DBPA Antibody (4D9) - Azide and BSA Free

• cold shock domain protein A
• Cold shock domain-containing protein A
• cold-shock domain protein A
• CSDA1
• dbpA
• DBPAcold-shock domain containing A1
• DNA-binding protein A
• Single-strand DNA-binding protein NF-GMB
• ZO-1-associated nucleic acid-binding protein
• ZONAB

Background

DBPA binds to the GM-CSF promoter. Seems to act as a repressor. Binds also to full length mRNA and to short RNA sequences containing the consensus site 5'-UCCAUCA-3'. May have a role in translation repression

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: YBX3
• Entrez:
  • 8531(Human)
• OMIM:
  • 603437(Human)
• Uniprot:
  • NP_003642(Human)