Novus Biologicals products are now on bio-techne.com

MUPP1 Antibody

Images

 
Western Blot: MUPP1 Antibody [NBP1-54331] - Hela, 293T cell lysate, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry-Paraffin: MUPP1 Antibody [NBP1-54331] - Human Kidney tissue, 5 ug/ml.
Western Blot: MUPP1 Antibody [NBP1-54331] - Lanes: Lane 1 : 30ug of HeLa cell lysate Lane 2: 30ug of 293T cell lysate Primary, Antibody Dilution: 1 : 2000 Secondary Antibody: Anti-rabbit-HRP Secondary, Antibody ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

MUPP1 Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to MPDZ(multiple PDZ domain protein) The peptide sequence was selected from the middle region of MPDZ. Peptide sequence DEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTLTIELQKKPGKGLGLSI. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MPDZ
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
Theoretical MW
218 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for MUPP1 Antibody

  • DKFZp781P216
  • FLJ25909
  • FLJ90240
  • Multi-PDZ domain protein 1
  • multiple PDZ domain protein
  • MUPP1FLJ34626

Background

The exact function of MPDZ remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NB100-1354
Species: Hu
Applications: Flow, IF, PEP-ELISA
NB300-952
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NB300-556
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB120-3344
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB300-556
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
H00009076-M01
Species: Hu, Pm, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
NB600-1229
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
AF7829
Species: Hu
Applications: ICC, IHC, WB
NBP2-72429
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
MAB4219
Species: Hu
Applications: CyTOF-ready, Flow
H00009223-M03
Species: Ca, Ha, Hu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-00594
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
H00057449-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-38696
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59254
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, WB
NBP1-81185
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-91809
Species: Hu
Applications: IHC, IHC-P

Publications for MUPP1 Antibody (NBP1-54331) (0)

There are no publications for MUPP1 Antibody (NBP1-54331).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MUPP1 Antibody (NBP1-54331) (0)

There are no reviews for MUPP1 Antibody (NBP1-54331). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MUPP1 Antibody (NBP1-54331) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MUPP1 Products

Array NBP1-54331

Research Areas for MUPP1 Antibody (NBP1-54331)

Find related products by research area.

Blogs on MUPP1

There are no specific blogs for MUPP1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MUPP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MPDZ