MUPP1 Antibody


Western Blot: MUPP1 Antibody [NBP1-54331] - Hela, 293T cell lysate, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry-Paraffin: MUPP1 Antibody [NBP1-54331] - Human Kidney tissue, 5 ug/ml.
Western Blot: MUPP1 Antibody [NBP1-54331] - Lanes: Lane 1 : 30ug of HeLa cell lysate Lane 2: 30ug of 293T cell lysate Primary, Antibody Dilution: 1 : 2000 Secondary Antibody: Anti-rabbit-HRP Secondary, Antibody more

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

MUPP1 Antibody Summary

Synthetic peptides corresponding to MPDZ(multiple PDZ domain protein) The peptide sequence was selected from the middle region of MPDZ. Peptide sequence DEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTLTIELQKKPGKGLGLSI.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against MPDZ and was validated on Western blot.
Theoretical MW
218 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MUPP1 Antibody

  • DKFZp781P216
  • FLJ25909
  • FLJ90240
  • Multi-PDZ domain protein 1
  • multiple PDZ domain protein
  • MUPP1FLJ34626


The exact function of MPDZ remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, ICC
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MUPP1 Antibody (NBP1-54331) (0)

There are no publications for MUPP1 Antibody (NBP1-54331).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MUPP1 Antibody (NBP1-54331) (0)

There are no reviews for MUPP1 Antibody (NBP1-54331). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MUPP1 Antibody (NBP1-54331) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Array NBP1-54331

Bioinformatics Tool for MUPP1 Antibody (NBP1-54331)

Discover related pathways, diseases and genes to MUPP1 Antibody (NBP1-54331). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MUPP1 Antibody (NBP1-54331)

Discover more about diseases related to MUPP1 Antibody (NBP1-54331).

Pathways for MUPP1 Antibody (NBP1-54331)

View related products by pathway.

PTMs for MUPP1 Antibody (NBP1-54331)

Learn more about PTMs related to MUPP1 Antibody (NBP1-54331).

Research Areas for MUPP1 Antibody (NBP1-54331)

Find related products by research area.

Blogs on MUPP1

There are no specific blogs for MUPP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MUPP1 Antibody and receive a gift card or discount.


Gene Symbol MPDZ