DBF4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DBF4 Antibody [NBP2-55268] - Staining of human cell line RH-30 shows localization to nucleoplasm & nuclear bodies.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DBF4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PHPSNELRGLNEKMSNKCSMLSTAEDDIRQNFTQLPLHKNKQECILDISEHTLSENDLEELRVDHYKCNIQASVHVSDFSTDNSGSQPKQKSDTVLFPAKDLKEKDLHSIFTHDSGLITINSSQ
Specificity
Specificity of human DBF4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DBF4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for DBF4 Antibody

  • ASKchif
  • DBF4 homolog (S. cerevisiae)
  • DBF4ACHIF
  • DBF4-type zinc finger-containing protein 1
  • ZDBF1DBF-type containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-10535
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, MiAr
NBP2-67481
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB92171
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-79193
Species: Hu, Rt, Po, Bv, Ca, Eq, GP, Rb
Applications: WB
NB100-288
Species: Hu, Xp
Applications: WB, IHC, IHC-P, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-48725
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56546
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87423
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-55408
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB600-230
Species: Hu
Applications: WB, IP, KD
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00000486-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-46192
Species: Hu
Applications: WB, IHC
NBP2-52983
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13900
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for DBF4 Antibody (NBP2-55268) (0)

There are no publications for DBF4 Antibody (NBP2-55268).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DBF4 Antibody (NBP2-55268) (0)

There are no reviews for DBF4 Antibody (NBP2-55268). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DBF4 Antibody (NBP2-55268) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DBF4 Products

Bioinformatics Tool for DBF4 Antibody (NBP2-55268)

Discover related pathways, diseases and genes to DBF4 Antibody (NBP2-55268). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DBF4 Antibody (NBP2-55268)

Discover more about diseases related to DBF4 Antibody (NBP2-55268).
 

Pathways for DBF4 Antibody (NBP2-55268)

View related products by pathway.

PTMs for DBF4 Antibody (NBP2-55268)

Learn more about PTMs related to DBF4 Antibody (NBP2-55268).
 

Research Areas for DBF4 Antibody (NBP2-55268)

Find related products by research area.

Blogs on DBF4

There are no specific blogs for DBF4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DBF4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DBF4