Recombinant Human DAZ3 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human DAZ3 Protein [H00057054-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human DAZ3 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 387-438 of Human DAZ3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: YPNSAVQVTTGYQFHVYNYQMPPQCPVGEQRRNLWTEAYKWWYLVCLIQRRD

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
DAZ3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
31.46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DAZ3 GST (N-Term) Protein

  • deleted in azoospermia 3
  • deleted in azoospermia protein 3
  • MGC126441
  • pDP1679

Background

DAZ3 - deleted in azoospermia 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001617-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-57481
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-80443
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-05663
Species: Hu, Mu, Rt
Applications: WB
NBP1-98290
Species: Hu
Applications: WB
NBP2-37463
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP1-30475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-75554
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-88527
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-20948
Species: Hu
Applications: WB
NBP1-31661
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80582
Species: Hu
Applications: IHC, IHC-P
NBP2-21792
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-46349
Species: Hu
Applications: IHC, WB
MAB7330
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-64852
Species: Ca, Hu
Applications: Flow, IHC, IHC-Fr

Publications for DAZ3 Partial Recombinant Protein (H00057054-Q01) (0)

There are no publications for DAZ3 Partial Recombinant Protein (H00057054-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DAZ3 Partial Recombinant Protein (H00057054-Q01) (0)

There are no reviews for DAZ3 Partial Recombinant Protein (H00057054-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DAZ3 Partial Recombinant Protein (H00057054-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DAZ3 Products

Array H00057054-Q01

Bioinformatics Tool for DAZ3 Partial Recombinant Protein (H00057054-Q01)

Discover related pathways, diseases and genes to DAZ3 Partial Recombinant Protein (H00057054-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DAZ3 Partial Recombinant Protein (H00057054-Q01)

Discover more about diseases related to DAZ3 Partial Recombinant Protein (H00057054-Q01).
 

Pathways for DAZ3 Partial Recombinant Protein (H00057054-Q01)

View related products by pathway.

Blogs on DAZ3

There are no specific blogs for DAZ3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RRM2 Antibody
NBP1-31661
BRD2 Antibody
NBP1-30475

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DAZ3 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DAZ3