Dact1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Dact1 Antibody [NBP1-85308] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Dact1 Antibody [NBP1-85308] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Dact1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VPLPYASPYAYVASDSEYSAECESLFHSTVVDTSEDEQSNYTTNCFGDSESSVSEGEFVGESTTTSDSEESGGLIWSQFVQTLPIQTVTAPDLHNHPAKTFVKIKASHNLKKKILRFRSGS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DACT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Dact1 Protein (NBP1-85308PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Dact1 Antibody

  • DAPPER
  • dapper, antagonist of beta-catenin, homolog 1 (Xenopus laevis)
  • DAPPER1dapper homolog 1, antagonist of beta-catenin (xenopus)
  • DPR1dapper homolog 1, antagonist of beta-catenin
  • FRODOdapper homolog 1
  • HDPR1
  • Hepatocellular carcinoma novel gene 3 protein
  • heptacellular carcinoma novel gene 3
  • HNG3
  • THYEX3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76955
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-24648
Species: Hu, Mu, Rt, Pm
Applications: WB
AF4815
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
AF1384
Species: Hu
Applications: WB, IHC, ICC
AF3287
Species: Hu, Mu, Rt
Applications: WB
NBP1-32388
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP1-86990
Species: Hu
Applications: WB, IHC, IHC-P
H00006575-M04
Species: Hu
Applications: WB, ELISA
NBP1-31406
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF6116
Species: Hu
Applications: WB, ICC
NBP1-83967
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF7164
Species: Hu
Applications: WB

Publications for Dact1 Antibody (NBP1-85308) (0)

There are no publications for Dact1 Antibody (NBP1-85308).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dact1 Antibody (NBP1-85308) (0)

There are no reviews for Dact1 Antibody (NBP1-85308). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Dact1 Antibody (NBP1-85308) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Dact1 Products

Bioinformatics Tool for Dact1 Antibody (NBP1-85308)

Discover related pathways, diseases and genes to Dact1 Antibody (NBP1-85308). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dact1 Antibody (NBP1-85308)

Discover more about diseases related to Dact1 Antibody (NBP1-85308).
 

Pathways for Dact1 Antibody (NBP1-85308)

View related products by pathway.

PTMs for Dact1 Antibody (NBP1-85308)

Learn more about PTMs related to Dact1 Antibody (NBP1-85308).
 

Research Areas for Dact1 Antibody (NBP1-85308)

Find related products by research area.

Blogs on Dact1

There are no specific blogs for Dact1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dact1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DACT1