![Western Blot: DAAM2 Antibody [NBP2-87243] - Host: Rabbit. Target Name: Daam2. Sample Type: Mouse Heart lysates. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize2/DAAM2-Antibody-Western-Blot-NBP2-87243-img0001.jpg "Western Blot: DAAM2 Antibody [NBP2-87243] - Host: Rabbit. Target Name: Daam2. Sample Type: Mouse Heart lysates. Antibody Dilution: 1.0ug/ml")
| Reactivity | MuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse DAAM2. Peptide sequence: RFAELVDELDLTDKNREAVFALPPEKKWQIYCSKRKEQEDPNKLATSWP The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DAAM2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry-Paraffin: FMNL2 Antibody [NBP2-24748] - Analysisof human brain, cortex using this antibody at 10 ug/ml.](http://images.novusbio.com/images2/FMNL2-Antibody-Immunohistochemistry-Paraffin-NBP2-24748-img0007.jpg)
![Immunohistochemistry-Paraffin: FMNL2 Antibody [NBP2-24748] - Staining of normal human brain using this antibody (FMNL2, figure A and control rabbit Ig, figure B) at 6 ug/ml.](http://images.novusbio.com/images2/FMNL2-Antibody-Immunohistochemistry-Paraffin-NBP2-24748-img0008.jpg)
![Western Blot: FMNL2 Antibody [NBP2-24748] - Analysis of Formin-like protein 2 in whole mouse embryo body tissue lysate in the 1) absence and 2) presence of immunizing peptide using this antibody at 2 ug/ml.](http://images.novusbio.com/images2/FMNL2-Antibody-Western-Blot-NBP2-24748-img0009.jpg)
![Immunohistochemistry-Paraffin: FMNL1 Antibody [NBP1-33431] - Paraffin-embedded U87 xenograft, using antibody at 1:500 dilution.](http://images.novusbio.com/images2/FMNL1-Antibody-Immunohistochemistry-Paraffin-NBP1-33431-img0002.jpg)
![Western Blot: FMNL1 Antibody [NBP1-33431] - H1299 lysates (Lane A) and Hela cells (Lane B) using NBP1-33431 at a dilution of 1:1000. 30ug whole cell lysate loaded on 7.5% SDS PAGE gel.](http://images.novusbio.com/images2/FMNL1-Antibody-Western-Blot-NBP1-33431-img0001.jpg)
![Western Blot: FMNL1 Antibody [NBP1-33431] - Sample (30 ug of whole cell lysate) A: Raji 5% SDS PAGE; antibody diluted at 1:1000.](http://images.novusbio.com/images2/FMNL1-Antibody-Western-Blot-NBP1-33431-img0003.jpg)
![Immunohistochemistry-Paraffin: GRID2IP Antibody [NBP1-94174] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.](http://images.novusbio.com/images2/GRID2IP-Antibody-Immunohistochemistry-Paraffin-NBP1-94174-img0002.jpg)
![Western Blot: GRID2IP Antibody [NBP1-94174] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: U-251 MG](http://images.novusbio.com/images2/GRID2IP-Antibody-Western-Blot-NBP1-94174-img0004.jpg)
![ELISA: FMN1 Antibody (4F4) [H00342184-M07] - Detection limit for recombinant GST tagged FMN1 is 3 ng/ml as a capture antibody.](http://images.novusbio.com/images2/FMN1-Antibody-(4F4)-ELISA-H00342184-M07-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: FMN1 Antibody (4F4) [H00342184-M07] - Analysis of monoclonal antibody to FMN1 on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/images2/FMN1-Antibody-(4F4)-Immunocytochemistry-Immunofluorescence-H00342184-M07-img0001.jpg)
![Western Blot: FMN1 Antibody (4F4) [H00342184-M07] - Analysis of FMN1 expression in human colon.](http://images.novusbio.com/images2/FMN1-Antibody-(4F4)-Western-Blot-H00342184-M07-img0004.jpg)
![Western Blot: FNBP3 Antibody [NBP1-87933] - Analysis using Anti-PRPF40A antibody NBP1-87933 (A) shows similar pattern to independent antibody NBP2-38400 (B).](http://images.novusbio.com/images2/FNBP3-Antibody-Western-Blot-NBP1-87933-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: FNBP3 Antibody [NBP1-87933] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.](http://images.novusbio.com/images2/FNBP3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87933-img0009.jpg)
![Immunohistochemistry-Paraffin: FNBP3 Antibody [NBP1-87933] - Staining of human rectum shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/images2/FNBP3-Antibody-Immunohistochemistry-Paraffin-NBP1-87933-img0002.jpg)
![Western Blot: FMN2 Antibody [NBP2-24615] - Analysis of FMN2 in human brain lysate in the 1) absence and 2) presence of immunizing peptide using NBP2-24615 at 0.25 ug/ml.](http://images.novusbio.com/images2/FMN2-Antibody-Western-Blot-NBP2-24615-img0001.jpg)
![Immunohistochemistry-Paraffin: FMN2 Antibody [NBP2-24615] - Tissue section of human brain using 1:300 dilution of FMN2 antibody. The signal was developed using HRP-labeled secondary and DAB reagent which followed counterstaining of nuclei with hematoxylin. This FMN2 antibody generated a nuclear and cytoplasmic staining primarily in the glial cells.](http://images.novusbio.com/images2/FMN2-Antibody-Immunohistochemistry-Paraffin-NBP2-24615-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: DIAPH3 Antibody (4D5) [H00081624-M01] - Analysis of monoclonal antibody to DIAPH3 on HeLa cell . Antibody concentration 10 ug/ml.](http://images.novusbio.com/images2/DIAPH3-Antibody-(4D5)-Immunocytochemistry-Immunofluorescence-H00081624-M01-img0002.jpg)
![Western Blot: DIAPH3 Antibody (4D5) [H00081624-M01] - Analysis of DIAPH3 expression in transfected 293T cell line by DIAPH3 monoclonal antibody (M01), clone 4D5.Lane 1: DIAPH3 transfected lysate (Predicted MW: 98.1 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/images2/DIAPH3-Antibody-(4D5)-Western-Blot-H00081624-M01-img0004.jpg)
![Sandwich ELISA: DIAPH3 Antibody (4D5) [H00081624-M01] - Detection limit for recombinant GST tagged DIAPH3 is 1 ng/ml as a capture antibody.](http://images.novusbio.com/images2/DIAPH3-Antibody-(4D5)-Sandwich-ELISA-H00081624-M01-img0003.jpg)
![Immunohistochemistry-Paraffin: FNBP1 Antibody [NBP2-48542] - Staining of human appendix shows strong cytoplasmic positivity in lymphoid tissue.](http://images.novusbio.com/images2/FNBP1-Antibody-Immunohistochemistry-Paraffin-NBP2-48542-img0002.jpg)
![Immunohistochemistry-Paraffin: FNBP1 Antibody [NBP2-48542] - Staining of human lymph node shows high expression.](http://images.novusbio.com/images2/FNBP1-Antibody-Immunohistochemistry-Paraffin-NBP2-48542-img0003.jpg)
![Western Blot: FNBP1 Antibody [NBP2-48542] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/images2/FNBP1-Antibody-Western-Blot-NBP2-48542-img0004.jpg)
![Immunohistochemistry-Paraffin: WBP4 Antibody [NBP1-84718] - Staining of human stomach shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/images2/WBP4-Antibody-Immunohistochemistry-Paraffin-NBP1-84718-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: WBP4 Antibody [NBP1-84718] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.](http://images.novusbio.com/images2/WBP4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84718-img0008.jpg)
![Western Blot: WBP4 Antibody [NBP1-84718] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/images2/WBP4-Antibody-Western-Blot-NBP1-84718-img0007.jpg)
![Flow Cytometry: Cortactin Antibody (SC61-08) [NBP2-67632] - Analysis of Hela cells with Cortactin antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.](http://images.novusbio.com/images2/Cortactin-Antibody-(SC61-08)-Flow-Cytometry-NBP2-67632-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: Cortactin Antibody (SC61-08) [NBP2-67632] - Staining Cortactin in A431 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.](http://images.novusbio.com/images2/Cortactin-Antibody-(SC61-08)-Immunocytochemistry-Immunofluorescence-NBP2-67632-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: Cortactin Antibody (SC61-08) [NBP2-67632] - Staining Cortactin in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.](http://images.novusbio.com/images2/Cortactin-Antibody-(SC61-08)-Immunocytochemistry-Immunofluorescence-NBP2-67632-img0003.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for DAAM2 Antibody (NBP2-87243)Discover more about diseases related to DAAM2 Antibody (NBP2-87243).
| Pathways for DAAM2 Antibody (NBP2-87243)View related products by pathway.
|
PTMs for DAAM2 Antibody (NBP2-87243)Learn more about PTMs related to DAAM2 Antibody (NBP2-87243).
|
|
Developmental regulator Daam2 promotes glial cell tumors by degrading Von Hippel-Lindau protein By Jamshed Arslan Pharm.D. Glioblastoma is an aggressive type of cancer that forms from the star-shaped glial cells of the central nervous system, called astrocytes. Intriguingly, several genes linked to glioblasto... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DAAM2 |
![ELISA: DAAM1 Antibody (4H3) [H00023002-M03] - Detection limit for recombinant GST tagged DAAM1 is approximately 1ng/ml as a capture antibody.](http://images.novusbio.com/images2/DAAM1-Antibody-(4H3)-ELISA-H00023002-M03-img0003.jpg)
![Proximity Ligation Assay: DAAM1 Antibody (4H3) [H00023002-M03] - Analysis of protein-protein interactions between RHOA and DAAM1. HeLa cells were stained with anti-RHOA rabbit purified polyclonal 1:1200 and anti-DAAM1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).](http://images.novusbio.com/images2/DAAM1-Antibody-(4H3)-Proximity-Ligation-Assay-H00023002-M03-img0004.jpg)
![Western Blot: DAAM1 Antibody (4H3) [H00023002-M03] - Analysis of DAAM1 expression in PC-12 (Cat # L012V1).](http://images.novusbio.com/images2/DAAM1-Antibody-(4H3)-Western-Blot-H00023002-M03-img0005.jpg)
![Western Blot: FMNL3 Antibody [NBP2-24724] - Analysis of Formin-like protein 3 in human brain lysate using this antibody. 1 ug/ml. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.](http://images.novusbio.com/images2/FMNL3-Antibody-Western-Blot-NBP2-24724-img0003.jpg)
![Immunohistochemistry-Paraffin: DIAPH1 Antibody [NB600-231] - FFPE section of human ovarian carcinoma. Affinity purified rabbit anti-Diaphanous1 used at a dilution of 1:100.](http://images.novusbio.com/images2/DIAPH1-Antibody-Immunohistochemistry-Paraffin-NB600-231-img0006.jpg)
![Western Blot: DIAPH1 Antibody [NB600-231] - Whole cell lysate (50 ug/lane) from untreated or siRNA treated 293T cells. Antibody used at 0.1 ug/ml.](http://images.novusbio.com/images2/DIAPH1-Antibody-Western-Blot-NB600-231-img0008.jpg)
![Western Blot: DIAPH1 Antibody [NB600-231] - Samples: Whole cell lysate (50 ug) from HeLa and 293T cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-Diaphanous 1 antibody used for WB at 0.66 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.](http://images.novusbio.com/images2/DIAPH1-Antibody-Western-Blot-NB600-231-img0009.jpg)
![Immunohistochemistry-Paraffin: DIAPH-2 Antibody [NBP1-85217] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/images2/DIAPH-2-Antibody-Immunohistochemistry-Paraffin-NBP1-85217-img0013.jpg)
![Immunohistochemistry-Paraffin: DIAPH-2 Antibody [NBP1-85217] - Staining of human placenta shows high expression.](http://images.novusbio.com/images2/DIAPH-2-Antibody-Immunohistochemistry-Paraffin-NBP1-85217-img0014.jpg)
![Immunohistochemistry-Paraffin: DIAPH-2 Antibody [NBP1-85217] - Staining in human placenta and pancreas tissues using anti-DIAPH2 antibody. Corresponding DIAPH2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/DIAPH-2-Antibody-Immunohistochemistry-Paraffin-NBP1-85217-img0015.jpg)
![Immunocytochemistry/Immunofluorescence: FHOD1 Antibody [NBP1-83900] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/images2/FHOD1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83900-img0004.jpg)
![Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900] - Staining of human cerebellum shows no cytoplasmic positivity in Purkinje cells as expected.](http://images.novusbio.com/images2/FHOD1-Antibody-Immunohistochemistry-Paraffin-NBP1-83900-img0005.jpg)
![Immunohistochemistry-Paraffin: FHOD1 Antibody [NBP1-83900] - Staining of human gastrointestinal shows strong cytoplasmic positivity in lymphoid cells.](http://images.novusbio.com/images2/FHOD1-Antibody-Immunohistochemistry-Paraffin-NBP1-83900-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: Filamin B Antibody [NBP1-90286] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol. Antibody staining is shown in green.](http://images.novusbio.com/images2/Filamin-B-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90286-img0015.jpg)
![Western Blot: Filamin B Antibody [NBP1-90286] - Analysis in human cell lines A-549 and HEK293 using anti-FLNB antibody. Corresponding FLNB RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.](http://images.novusbio.com/images2/Filamin-B-Antibody-Western-Blot-NBP1-90286-img0017.jpg)
![Immunohistochemistry-Paraffin: Filamin B Antibody [NBP1-90286] - Staining of human colon, placenta, prostate and skeletal muscle using Anti-Filamin B antibody NBP1-90286 (A) shows similar protein distribution across tissues to independent antibody NBP1-90285 (B).](http://images.novusbio.com/images2/Filamin-B-Antibody-Immunohistochemistry-Paraffin-NBP1-90286-img0027.jpg)
![Immunohistochemistry-Paraffin: FHDC1 Antibody [NBP1-93579] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/images2/FHDC1-Antibody-Immunohistochemistry-Paraffin-NBP1-93579-img0001.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](http://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
