![Western Blot: Cytokeratin 7 Antibody (5V4M10) [NBP3-16388] - Western blot analysis of various lysates using Cytokeratin 7 Rabbit mAb at 1:20000 dilution incubated at room temperature for 1.5 hours.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Negative control (NC): MCF-7Exposure time: 1s.](http://images.novusbio.com/fullsize/nbp3-16388_rabbit-cytokeratin-7-mab-5v4m10-522025125454.jpg "Western Blot: Cytokeratin 7 Antibody (5V4M10) [NBP3-16388] - Western blot analysis of various lysates using Cytokeratin 7 Rabbit mAb at 1:20000 dilution incubated at room temperature for 1.5 hours.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Negative control (NC): MCF-7Exposure time: 1s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | 5V4M10 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Description | Novus Biologicals Rabbit Cytokeratin 7 Antibody (5V4M10) (NBP3-16388) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 291-463 of human Cytokeratin 7 (KRT7) (P08729). QAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAALQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASAS |
| Source | HEK293 |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | KRT7 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Cytokeratin 7 Antibody (NBP3-16388)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KRT7 |
![Immunocytochemistry/ Immunofluorescence: Cytokeratin 7 Antibody (5V4M10) [NBP3-16388] - Immunofluorescence analysis of paraffin-embedded Human lung tissue using Cytokeratin 7 Rabbit mAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-16388_rabbit-cytokeratin-7-mab-5v4m10-52202511411483.jpg "Immunocytochemistry/ Immunofluorescence: Cytokeratin 7 Antibody (5V4M10) [NBP3-16388] - Immunofluorescence analysis of paraffin-embedded Human lung tissue using Cytokeratin 7 Rabbit mAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunohistochemistry: Cytokeratin 7 Antibody (5V4M10) [NBP3-16388] - Immunohistochemistry analysis of paraffin-embedded Human lung adenocarcinoma using Cytokeratin 7 Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16388_rabbit-cytokeratin-7-mab-5v4m10-5220251242545.jpg "Immunohistochemistry: Cytokeratin 7 Antibody (5V4M10) [NBP3-16388] - Immunohistochemistry analysis of paraffin-embedded Human lung adenocarcinoma using Cytokeratin 7 Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.")
![Immunohistochemistry: Cytokeratin 7 Antibody (5V4M10) [NBP3-16388] - Immunohistochemistry analysis of paraffin-embedded Human breast using Cytokeratin 7 Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16388_rabbit-cytokeratin-7-mab-5v4m10-522025113898.jpg "Immunohistochemistry: Cytokeratin 7 Antibody (5V4M10) [NBP3-16388] - Immunohistochemistry analysis of paraffin-embedded Human breast using Cytokeratin 7 Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.")
![Immunohistochemistry: Cytokeratin 7 Antibody (5V4M10) [NBP3-16388] - Immunohistochemistry analysis of paraffin-embedded Human lung using Cytokeratin 7 Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16388_rabbit-cytokeratin-7-mab-5v4m10-5220251265313.jpg "Immunohistochemistry: Cytokeratin 7 Antibody (5V4M10) [NBP3-16388] - Immunohistochemistry analysis of paraffin-embedded Human lung using Cytokeratin 7 Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.")
![Immunocytochemistry/ Immunofluorescence: Cytokeratin 7 Antibody (5V4M10) [NBP3-16388] - Immunofluorescence analysis of paraffin-embedded Rat lung tissue using Cytokeratin 7 Rabbit mAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-16388_rabbit-cytokeratin-7-mab-5v4m10-52202511411491.jpg "Immunocytochemistry/ Immunofluorescence: Cytokeratin 7 Antibody (5V4M10) [NBP3-16388] - Immunofluorescence analysis of paraffin-embedded Rat lung tissue using Cytokeratin 7 Rabbit mAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: Cytokeratin 7 Antibody (5V4M10) [NBP3-16388] - Immunofluorescence analysis of paraffin-embedded Mouse lung tissue using Cytokeratin 7 Rabbit mAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-16388_rabbit-cytokeratin-7-mab-5v4m10-52202511392235.jpg "Immunocytochemistry/ Immunofluorescence: Cytokeratin 7 Antibody (5V4M10) [NBP3-16388] - Immunofluorescence analysis of paraffin-embedded Mouse lung tissue using Cytokeratin 7 Rabbit mAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunohistochemistry Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neprilysin_AF1126_Immunohistochemistry_6679.jpg)
![Western Blot Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images/af1126_mouse-neprilysin-affinity-purified-polyclonal-ab-8220249505976.jpg)
![Western Blot Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images/af1126_mouse-neprilysin-affinity-purified-polyclonal-ab-44202415433122.jpg)
![Immunohistochemistry CEACAM7 Antibody [Unconjugated]](https://images.novusbio.com/images2/CEACAM7_AF4478_Immunohistochemistry_20616.jpg)
![Western Blot CEACAM7 Antibody [Unconjugated]](https://images.novusbio.com/images2/CEACAM-7_AF4478_Western_Blot_5475.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")