Cytokeratin 6 Antibody (3F7A1) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 465-564 of human Cytokeratin 6 (P48668). YRKLLEGEECRLNGEGVGQVNVSVVQSTISSGYGGASGVGSGLGLGGGSSYSYGSGLGIGGGFSSSSGRAIGGGLSSVGGGSSTIKYTTTSSSSRKSYKH |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
KRT6A |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Cytokeratin 6 Antibody (3F7A1)
Background
Keratins 6 and 16 are expressed in keratinocytes, which are undergoing rapid turnover in the suprabasal region (also known as hyperproliferation related keratins). Keratin 6 is found in hair follicles, neck squamous cell carcinomas, suprabasal cells of a variety of internal stratified epithelia, in epidermis, in both normal and hyperproliferative situations. Epidermal injury results in activation of keratinocytes which express CK6 and CK16. CK6 is strongly expressed in about 75% of head and neck squamous cell carcinomas. Expression of CK6 is particularly associated with differentiation. There are at least six isoforms of human type II keratin 6 (K6), K6A being the most abundant representing about 77% of all forms found in epithelia.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Gt, Hu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ch, Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu
Applications: ICC
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, In vivo, KO, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Publications for Cytokeratin 6 Antibody (NBP3-15324) (0)
There are no publications for Cytokeratin 6 Antibody (NBP3-15324).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Cytokeratin 6 Antibody (NBP3-15324) (0)
There are no reviews for Cytokeratin 6 Antibody (NBP3-15324).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Cytokeratin 6 Antibody (NBP3-15324) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Cytokeratin 6 Products
Research Areas for Cytokeratin 6 Antibody (NBP3-15324)
Find related products by research area.
|
Blogs on Cytokeratin 6