Cytokeratin 16 Antibody (8L6R4)

Western Blot: Cytokeratin 16 Antibody (8L6R4) [NBP3-16678] - Western blot analysis of extracts of Mouse large intestine cells, using Cytokeratin 16 antibody (NBP3-16678) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 180s.

Immunohistochemistry: Cytokeratin 16 Antibody (8L6R4) [NBP3-16678] - Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using Cytokeratin 16 Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Cytokeratin 16 Antibody (8L6R4) [NBP3-16678] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Cytokeratin 16 Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: Cytokeratin 16 Antibody (8L6R4) [Cytokeratin 16] - Confocal imaging of paraffin-embedded Human skin using Cytokeratin 16 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 8L6R4
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Cytokeratin 16 Antibody (8L6R4) Summary

• Description: Novus Biologicals Rabbit Cytokeratin 16 Antibody (8L6R4) (NBP3-16678) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 16 (P08779). MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVLAGGSCRAPSTYGGGLSVSSRFSSGGACGLGGGYGGGFSSSSSFGSGFGGGYGGGLGAGFGGGLGA
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: KRT16
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:100 - 1:400
  • Immunohistochemistry 1:500 - 1:2000
  • Immunohistochemistry-Paraffin 1:500 - 1:2000
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 51 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Cytokeratin 16 Antibody (8L6R4)

• CK16
• CK-16
• cytokeratin 16
• cytokeratin-16
• FNEPPK
• focal non-epidermolytic palmoplantar keratoderma
• K16
• K1CP
• keratin 16
• keratin, type I cytoskeletal 16
• keratin-16
• KRT16A
• NEPPK

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KRT16