Cytohesin 2 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: REELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKF |
| Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CYTH2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Cytohesin 2 Antibody - BSA Free
Background
Pleckstrin homology, Sec7 and coiled/coil domains 2 (PSCD2) is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. PSCD2 exhibits GEP activity in vitro with ARF1, ARF3, and ARF6. PSCD2 protein is 83% homologous to PSCD1. Two transcript variants encoding different isoforms have been found for this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Rt
Applications: ICC/IF, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Publications for Cytohesin 2 Antibody (NBP2-68764) (0)
There are no publications for Cytohesin 2 Antibody (NBP2-68764).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Cytohesin 2 Antibody (NBP2-68764) (0)
There are no reviews for Cytohesin 2 Antibody (NBP2-68764).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Cytohesin 2 Antibody (NBP2-68764) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Cytohesin 2 Products
Research Areas for Cytohesin 2 Antibody (NBP2-68764)
Find related products by research area.
|
Blogs on Cytohesin 2