Cytohesin 2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Cytohesin 2 Antibody [NBP2-68764] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cytohesin 2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Cytohesin 2 Antibody - BSA Free (NBP2-68764) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: REELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKF
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CYTH2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
• Control Peptide:

  Cytohesin 2 Recombinant Protein Antigen (NBP2-68764PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Cytohesin 2 Antibody - BSA Free

• ARF exchange factor
• ARF nucleotide-binding site opener
• ARNO
• ARNOPH, SEC7 and coiled-coil domain-containing protein 2
• CTS18.1
• CYTH2
• Cytohesin 2
• pleckstrin homology, Sec7 and coiled-coil domains 2 (cytohesin-2)
• Protein ARNO
• PSCD2
• PSCD2L
• PSCD2LCTS18
• PSCD2pleckstrin homology, Sec7 and coiled-coil domains 2
• Sec7 and coiled/coil domains 2 (cytohesin-2)

Background

Pleckstrin homology, Sec7 and coiled/coil domains 2 (PSCD2) is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. PSCD2 exhibits GEP activity in vitro with ARF1, ARF3, and ARF6. PSCD2 protein is 83% homologous to PSCD1. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CYTH2