Cytohesin 3 Antibody - BSA Free

Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and in leydig cells.

Staining of human liver shows no positivity as expected.

Analysis in human cell line U-2 OS.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cytohesin 3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Cytohesin 3 Antibody - BSA Free (NBP1-90097) is a polyclonal antibody validated for use in IHC and WB. Anti-Cytohesin 3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEESKTTQRNKQIAM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CYTH3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Cytohesin 3 Protein (NBP1-90097PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (86%). Mouse reactivity reported in scientific literature (PMID: 26239146).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Cytohesin 3 Antibody - BSA Free

• ARF nucleotide-binding site opener 3
• ARNO3PH, SEC7 and coiled-coil domain-containing protein 3
• cytohesin 3
• General receptor of phosphoinositides 1
• Grp1
• GRP1cytohesin-3
• pleckstrin homology, Sec7 and coiled-coil domains 3
• Protein ARNO3
• PSCD3pleckstrin homology, Sec7 and coiled/coil domains 3

Background

Specificity: A synthetic

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Cytohesin 3 Antibody (NBP1-90097)(1)

Publication using NBP1-90097

• Tsunaki Hongu, Yuji Funakoshi, Shigetomo Fukuhara et al. Arf6 regulates tumour angiogenesis and growth through HGF-induced endothelial beta1 integrin recycling. Nature Communications 2015-01-01 [PMID: 26239146] (IF/IHC, Mouse)

Bioinformatics

• Gene Symbol: CYTH3