IPCEF1 Antibody

Images

 
Immunohistochemistry-Paraffin: IPCEF1 Antibody [NBP1-83010] - Staining of human tonsil shows strong cytoplasmic positivity in subsets of lymphoid cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IPCEF1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LNSLSSDDTSSLSSNHDHLTVPDKPAGSKIMDKEETKVSEDDEMEKLYKSLEQASLSPLGDRR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IPCEF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
IPCEF1 Protein (NBP1-83010PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IPCEF1 Antibody

  • interaction protein for cytohesin exchange factors 1
  • interactor protein for cytohesin exchange factors 1
  • KIAA0403interaction protein for cytohesin exchange factors 1 Interaction protein forcytohesin exchange factors 1
  • phosphoinositide binding protein PIP3-E
  • Phosphoinositide-binding protein PIP3-E
  • PIP3-E
  • RP3-402L9.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009266-M02
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NB110-40561
Species: Hu
Applications: WB, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00114757-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-19779
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00154043-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-50811
Species: Hu
Applications: WB, ELISA, IA, S-ELISA
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF6260
Species: Hu
Applications: WB
AF4817
Species: Mu
Applications: WB
NBP1-83010
Species: Hu
Applications: IHC, IHC-P

Publications for IPCEF1 Antibody (NBP1-83010) (0)

There are no publications for IPCEF1 Antibody (NBP1-83010).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IPCEF1 Antibody (NBP1-83010) (0)

There are no reviews for IPCEF1 Antibody (NBP1-83010). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IPCEF1 Antibody (NBP1-83010) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IPCEF1 Products

Bioinformatics Tool for IPCEF1 Antibody (NBP1-83010)

Discover related pathways, diseases and genes to IPCEF1 Antibody (NBP1-83010). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IPCEF1 Antibody (NBP1-83010)

Discover more about diseases related to IPCEF1 Antibody (NBP1-83010).

PTMs for IPCEF1 Antibody (NBP1-83010)

Learn more about PTMs related to IPCEF1 Antibody (NBP1-83010).

Blogs on IPCEF1

There are no specific blogs for IPCEF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IPCEF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IPCEF1