![Western Blot: Cytochrome b5 Outer Mitochondrial Membrane Antibody [H00080777-B01P] - Analysis of CYB5-M expression in human liver.](http://images.novusbio.com/fullsize/Cytochrome-b5-Outer-Mitochondrial-Membrane-Antibody-Western-Blot-H00080777-B01P-img0004.jpg "Western Blot: Cytochrome b5 Outer Mitochondrial Membrane Antibody [H00080777-B01P] - Analysis of CYB5-M expression in human liver.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | CYB5B (AAH04373.1, 1 a.a. - 146 a.a.) full-length human protein. MATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVLLGFLYRYYTSESKSS |
| Specificity | Reacts with cytochrome b5 type B (outer mitochondrial membrane). |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | CYB5B |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This antibody is reactive against tissue and transfected lysate in western blot, and as a detection antibody in ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Cytochrome b5 Outer Mitochondrial Membrane Antibody (H00080777-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CYB5B |
| Entrez |
|
| Uniprot |
|
![Western Blot: Cytochrome b5 Outer Mitochondrial Membrane Antibody [H00080777-B01P] - Analysis of CYB5B expression in Jurkat.](http://images.novusbio.com/fullsize/Cytochrome-b5-Outer-Mitochondrial-Membrane-Antibody-Western-Blot-H00080777-B01P-img0003.jpg "Western Blot: Cytochrome b5 Outer Mitochondrial Membrane Antibody [H00080777-B01P] - Analysis of CYB5B expression in Jurkat.")
![Western Blot: Cytochrome b5 Outer Mitochondrial Membrane Antibody [H00080777-B01P] - Analysis of CYB5B expression in transfected 293T cell line by CYB5B polyclonal antibody. Lane 1: CYB5-M transfected lysate(16.06 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Cytochrome-b5-Outer-Mitochondrial-Membrane-Antibody-Western-Blot-H00080777-B01P-img0005.jpg "Western Blot: Cytochrome b5 Outer Mitochondrial Membrane Antibody [H00080777-B01P] - Analysis of CYB5B expression in transfected 293T cell line by CYB5B polyclonal antibody. Lane 1: CYB5-M transfected lysate(16.06 KDa). Lane 2: Non-transfected lysate.")
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")