Cystatin E/M/CST6 Antibody (2H8)

Images

 
Western Blot: Cystatin E/M/CST6 Antibody (2H8) [H00001474-M01] - Analysis of CST6 expression in transfected 293T cell line by CST6 monoclonal antibody (M01), clone 2H8.Lane 1: CST6 transfected lysate (Predicted MW: 16.5 ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2H8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cystatin E/M/CST6 Antibody (2H8) Summary

Immunogen
CST6 (AAH31334, 29 a.a. - 149 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM
Specificity
CST6 (2H8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CST6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cystatin E/M/CST6 Antibody (2H8)

  • CST6
  • cystatin 6
  • Cystatin E/M
  • cystatin M
  • cystatin M/E
  • Cystatin-6
  • cystatin-E
  • cystatin-M
  • cysteine proteinase inhibitor

Background

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. This gene encodes a cystatin from the type 2 family, which is down-regulated in metastatic breast tumor cells as compared to primary tumor cells. Loss of expression is likely associated with the progression of a primary tumor to a metastatic phenotype.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP
AF2199
Species: Hu
Applications: WB, IP
1407-PI
Species: Hu
AF1013
Species: Mu
Applications: WB, IHC, IP
AF1408
Species: Hu, Rt
Applications: WB, Simple Western, IHC, IP
MAB1080
Species: Hu
Applications: WB, IHC, IP
MAB1296
Species: Hu
Applications: WB, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00001513-M01
Species: Hu
Applications: WB, ELISA, IHC-P
MAB1569
Species: Hu
Applications: WB, IHC, IP
AF1029
Species: Mu
Applications: WB, IHC, IP
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-20310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
1407-PI
Species: Hu
NBP2-45562
Species: Hu
Applications: WB, Flow, IHC
AF4604
Species: Hu
Applications: WB, IHC
H00001474-M01
Species: Hu
Applications: WB, ELISA

Publications for Cystatin E/M/CST6 Antibody (H00001474-M01) (0)

There are no publications for Cystatin E/M/CST6 Antibody (H00001474-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cystatin E/M/CST6 Antibody (H00001474-M01) (0)

There are no reviews for Cystatin E/M/CST6 Antibody (H00001474-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cystatin E/M/CST6 Antibody (H00001474-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cystatin E/M/CST6 Products

Bioinformatics Tool for Cystatin E/M/CST6 Antibody (H00001474-M01)

Discover related pathways, diseases and genes to Cystatin E/M/CST6 Antibody (H00001474-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cystatin E/M/CST6 Antibody (H00001474-M01)

Discover more about diseases related to Cystatin E/M/CST6 Antibody (H00001474-M01).
 

Pathways for Cystatin E/M/CST6 Antibody (H00001474-M01)

View related products by pathway.

PTMs for Cystatin E/M/CST6 Antibody (H00001474-M01)

Learn more about PTMs related to Cystatin E/M/CST6 Antibody (H00001474-M01).
 

Research Areas for Cystatin E/M/CST6 Antibody (H00001474-M01)

Find related products by research area.

Blogs on Cystatin E/M/CST6

There are no specific blogs for Cystatin E/M/CST6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cystatin E/M/CST6 Antibody (2H8) and receive a gift card or discount.

Bioinformatics

Gene Symbol CST6
Entrez
OMIM
Uniprot