Cystatin A Antibody (1A11)

Images

 
Sandwich ELISA: Cystatin A Antibody (1A11) [H00001475-M01] - Detection limit for recombinant GST tagged CSTA is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1A11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cystatin A Antibody (1A11) Summary

Immunogen
CSTA (AAH10379, 1 a.a. - 98 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Specificity
CSTA - cystatin A (stefin A) (1A11)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CSTA
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cystatin A Antibody (1A11)

  • CSTA
  • cystatin A (stefin A)
  • Cystatin A
  • cystatin AS
  • cystatin-A
  • Keratolinin
  • Stefin A
  • STF1
  • STF1Cystatin-AS
  • STFAStefin-A

Background

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins, and kininogens. This gene encodes a stefin that functions as a cysteine protease inhibitor, forming tight complexes with papain and the cathepsins B, H, and L. The protein is one of the precursor proteins of cornified cell envelope in keratinocytes and plays a role in epidermal development and maintenance. Stefins have been proposed as prognostic and diagnostic tools for cancer. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

1407-PI
Species: Hu
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP
AF1408
Species: Hu, Rt
Applications: WB, Simple Western, IHC, IP
AF1013
Species: Mu
Applications: WB, IHC, IP
AF1286
Species: Hu
Applications: WB, Simple Western, IHC, IP
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
AF1029
Species: Mu
Applications: WB, IHC, IP
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NB100-1844
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P

Publications for Cystatin A Antibody (H00001475-M01) (0)

There are no publications for Cystatin A Antibody (H00001475-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cystatin A Antibody (H00001475-M01) (0)

There are no reviews for Cystatin A Antibody (H00001475-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cystatin A Antibody (H00001475-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cystatin A Products

Bioinformatics Tool for Cystatin A Antibody (H00001475-M01)

Discover related pathways, diseases and genes to Cystatin A Antibody (H00001475-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cystatin A Antibody (H00001475-M01)

Discover more about diseases related to Cystatin A Antibody (H00001475-M01).
 

Pathways for Cystatin A Antibody (H00001475-M01)

View related products by pathway.

PTMs for Cystatin A Antibody (H00001475-M01)

Learn more about PTMs related to Cystatin A Antibody (H00001475-M01).
 

Research Areas for Cystatin A Antibody (H00001475-M01)

Find related products by research area.

Blogs on Cystatin A

There are no specific blogs for Cystatin A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cystatin A Antibody (1A11) and receive a gift card or discount.

Bioinformatics

Gene Symbol CSTA
Entrez
Uniprot