CYP51A1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

CYP51A1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CYP51A1.
  
  

  Source: E. coli

  Amino Acid Sequence: RSQLNEKVAQLYADLDGGFSHAAWLLPGWLPLPSFRRRDRAHREIKDIFYKAIQKRRQSQEKIDDILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQH

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CYP51A1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48733.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 29 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CYP51A1 Recombinant Protein Antigen

• CP51
• CYP51
• CYP51A1
• CYP51Cytochrome P450LI
• CYPL1
• CYPLI
• Cytochrome P450 51A1
• cytochrome P450, family 51, subfamily A, polypeptide 1
• Cytochrome P45014DM
• Cytochrome P450-14DM
• Cytochrome P450LI
• EC 1.14.13.70
• EC 1.14.14.154
• lanosterol 14-alpha demethylase
• lanosterol 14-alpha-demethylase
• LDM
• LDMCytochrome P45014DM
• P450-14DM
• P450L1,51 (lanosterol 14-alpha-demethylase)
• Sterol 14-alpha demethylase

Background

CYP51A1, also known as Lanosterol 14-alpha demethylase, consists of a 56.8 kDa and a 46.3 kDa isoform and is involved in transforming lanosterol by removing the 14alpha-methyl group. Current research is being conducted with several diseases including tuberculosis, antley-bixler syndrome, colorectal cancer, leukemia, immunodeficiency, prostatitis, cholesterol, and chagas disease. This protein has been linked to the cholesterol and steroid biosynthesis, metabolism, and signaling pathways, where it interacts with FA2H, MSMO1, SCD, ZMPSTE24, and FDFT1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CYP51A1