CYP51A1 Recombinant Protein Antigen

Images

 
There are currently no images for CYP51A1 Recombinant Protein Antigen (NBP2-48733PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CYP51A1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CYP51A1.

Source: E. coli

Amino Acid Sequence: RSQLNEKVAQLYADLDGGFSHAAWLLPGWLPLPSFRRRDRAHREIKDIFYKAIQKRRQSQEKIDDILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQH

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CYP51A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-48733.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for CYP51A1 Recombinant Protein Antigen

  • CP51
  • CYP51
  • CYP51A1
  • CYP51Cytochrome P450LI
  • CYPL1
  • CYPLI
  • Cytochrome P450 51A1
  • cytochrome P450, family 51, subfamily A, polypeptide 1
  • Cytochrome P45014DM
  • Cytochrome P450-14DM
  • Cytochrome P450LI
  • EC 1.14.13.70
  • EC 1.14.14.154
  • lanosterol 14-alpha demethylase
  • lanosterol 14-alpha-demethylase
  • LDM
  • LDMCytochrome P45014DM
  • P450-14DM
  • P450L1,51 (lanosterol 14-alpha-demethylase)
  • Sterol 14-alpha demethylase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-81657
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-78444
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
MAB9120
Species: Hu
Applications: ICC
NBP2-66888
Species: Hu, Mu, Rt
Applications: IHC-P, IP, Simple Western, WB
NBP2-37502
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB100-1596
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-01170
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-47914
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-10064
Species: Hu
Applications: WB
H00001390-M02
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
NBP2-45435
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB600-582
Species: Ca, Ch, SyHa, Ha, Hu, Pm, Mu, Rt
Applications: IHC-Fr, KO, Simple Western, WB
NBP2-76827
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-78159
Species: Bv, Hu, Po, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, RIA, WB
NB110-39113
Species: Hu, Mu, Rb, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
NBP2-38770
Species: Hu, Mu
Applications: IHC-P, WB

Publications for CYP51A1 Recombinant Protein Antigen (NBP2-48733PEP) (0)

There are no publications for CYP51A1 Recombinant Protein Antigen (NBP2-48733PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP51A1 Recombinant Protein Antigen (NBP2-48733PEP) (0)

There are no reviews for CYP51A1 Recombinant Protein Antigen (NBP2-48733PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CYP51A1 Recombinant Protein Antigen (NBP2-48733PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CYP51A1 Products

Array NBP2-48733PEP

Bioinformatics Tool for CYP51A1 Recombinant Protein Antigen (NBP2-48733PEP)

Discover related pathways, diseases and genes to CYP51A1 Recombinant Protein Antigen (NBP2-48733PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP51A1 Recombinant Protein Antigen (NBP2-48733PEP)

Discover more about diseases related to CYP51A1 Recombinant Protein Antigen (NBP2-48733PEP).
 

Pathways for CYP51A1 Recombinant Protein Antigen (NBP2-48733PEP)

View related products by pathway.

PTMs for CYP51A1 Recombinant Protein Antigen (NBP2-48733PEP)

Learn more about PTMs related to CYP51A1 Recombinant Protein Antigen (NBP2-48733PEP).
 

Research Areas for CYP51A1 Recombinant Protein Antigen (NBP2-48733PEP)

Find related products by research area.

Blogs on CYP51A1

There are no specific blogs for CYP51A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CYP51A1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP51A1