Recombinant Human CYP46A1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CYP46A1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 201-300 of Human CYP46A1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLDNFVTFF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CYP46A1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CYP46A1 Protein

  • CH24H
  • cholesterol 24-hydroxylase
  • CYP46CP46
  • Cytochrome P450 46A1
  • cytochrome P450, family 46, subfamily A, polypeptide 1
  • cytochrome P450, subfamily 46 (cholesterol 24-hydroxylase)
  • EC 1.14.13.98

Background

CYP46A1 - cytochrome P450, family 46, subfamily A, polypeptide 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NBP2-32433
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
MAB9120
Species: Hu
Applications: ICC
NBP1-32247
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-09138
Species: Hu
NB400-157
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB4077
Species: Hu
Applications: WB, IHC
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-50216
Species: Hu
Applications: WB, ELISA, IHC
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA

Publications for CYP46A1 Partial Recombinant Protein (H00010858-Q01) (0)

There are no publications for CYP46A1 Partial Recombinant Protein (H00010858-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP46A1 Partial Recombinant Protein (H00010858-Q01) (0)

There are no reviews for CYP46A1 Partial Recombinant Protein (H00010858-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYP46A1 Partial Recombinant Protein (H00010858-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CYP46A1 Products

Bioinformatics Tool for CYP46A1 Partial Recombinant Protein (H00010858-Q01)

Discover related pathways, diseases and genes to CYP46A1 Partial Recombinant Protein (H00010858-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP46A1 Partial Recombinant Protein (H00010858-Q01)

Discover more about diseases related to CYP46A1 Partial Recombinant Protein (H00010858-Q01).
 

Pathways for CYP46A1 Partial Recombinant Protein (H00010858-Q01)

View related products by pathway.

PTMs for CYP46A1 Partial Recombinant Protein (H00010858-Q01)

Learn more about PTMs related to CYP46A1 Partial Recombinant Protein (H00010858-Q01).
 

Research Areas for CYP46A1 Partial Recombinant Protein (H00010858-Q01)

Find related products by research area.

Blogs on CYP46A1

There are no specific blogs for CYP46A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ABCA1 Antibody
NB400-105
GM-CSF [Unconjugated]
215-GM-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CYP46A1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP46A1