CYP39A1 Antibody - BSA Free

Western Blot: CYP39A1 Antibody [NBP2-83987] - Host: Rabbit. Target Name: CYP39A1. Sample Tissue: Mouse Heart lysates. Antibody Dilution: 1ug/ml

Product Discontinued

CYP39A1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle terminal region of mouse CYP39A1. Peptide sequence: PGVITRKVVKPVKILNHTVPSGDLLMLSPFWLHRNPKYFPEPESFKPERW The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CYP39A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CYP39A1 Antibody - BSA Free

• Cytochrome P450 39A1
• cytochrome P450, family 39, subfamily A, polypeptide 1
• cytochrome P450, subfamily XXXIX (oxysterol 7 alpha-hydroxylase), polypeptide 1,24-hydroxycholesterol 7-alpha-hydroxylase
• EC 1.14.13.99
• hCYP39A1
• Oxysterol 7-alpha-hydroxylase
• oxysterol 7alpha-hydroxylase

Background

The CYP39A1 gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins aremonooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids andother lipids. This endoplasmic ret

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CYP39A1