CYP2S1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CYP2S1 Antibody [NBP2-55469] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CYP2S1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GTVAMLEGTFDGHGVFFSNGERWRQLRKFTMLALRDLGMGKREGEELIQAEARCLVETFQGTEGRPFDPSLLLAQATSNVVCSLL
Specificity
Specificity of human CYP2S1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYP2S1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CYP2S1 Recombinant Protein Antigen (NBP2-55469PEP)

Reactivity Notes

Mouse 82%, Rat 80%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CYP2S1 Antibody

  • CYPIIS1
  • cytochrome P450 2S1
  • cytochrome P450 family member predicted from ESTs
  • cytochrome P450, family 2, subfamily S, polypeptide 1
  • cytochrome P450, subfamily IIS, polypeptide 1
  • cytochrome P540, subfamily IIS, polypeptide 1
  • EC 1.14.14.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-128
Species: Hu, Mu, Rt
Applications: GS, ICC/IF, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24722
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-50205
Species: Hu
Applications: WB, ELISA, IHC
NBP2-33467
Species: Hu
Applications: IHC, IHC-P
NBP2-16061
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-92810
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-01437
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-01800
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-50204
Species: Hu, Mu
Applications: WB, ELISA, IHC
NB100-124
Species: Hu, Mu, Rt, Bv, Ma, Pm, Sh
Applications: WB, ChIP, GS, IB, ICC/IF, IHC, IHC-P, IP, CHIP-SEQ
NBP1-59786
Species: Hu
Applications: WB
NBP2-50209
Species: Hu
Applications: WB, ELISA, IHC
NBP1-86142
Species: Hu
Applications: WB, IHC, IHC-P
H00001573-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA

Publications for CYP2S1 Antibody (NBP2-55469) (0)

There are no publications for CYP2S1 Antibody (NBP2-55469).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP2S1 Antibody (NBP2-55469) (0)

There are no reviews for CYP2S1 Antibody (NBP2-55469). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CYP2S1 Antibody (NBP2-55469) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CYP2S1 Products

Bioinformatics Tool for CYP2S1 Antibody (NBP2-55469)

Discover related pathways, diseases and genes to CYP2S1 Antibody (NBP2-55469). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP2S1 Antibody (NBP2-55469)

Discover more about diseases related to CYP2S1 Antibody (NBP2-55469).
 

Pathways for CYP2S1 Antibody (NBP2-55469)

View related products by pathway.

PTMs for CYP2S1 Antibody (NBP2-55469)

Learn more about PTMs related to CYP2S1 Antibody (NBP2-55469).
 

Research Areas for CYP2S1 Antibody (NBP2-55469)

Find related products by research area.

Blogs on CYP2S1

There are no specific blogs for CYP2S1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYP2S1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP2S1