CYP2A13 Antibody

Images

 
Western Blot: CYP2A13 Antibody [H00001553-B01P] - Analysis of CYP2A13 expression in transfected 293T cell line by CYP2A13 polyclonal antibody. Lane 1: CYP2A13 transfected lysate(54.34 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CYP2A13 Antibody Summary

Immunogen
CYP2A13 (AAI53001.1, 1 a.a. - 494 a.a.) full-length human protein. MLASGLLLVTLLACLTVMVLMSVWRQRKSRGKLPPGPTPLPFIGNYLQLNTEQMYNSLMKISERYGPVFTIHLGPRRVVVLCGHDAVKEALVDQAEEFSGRGEQATFDWLFKGYGVAFSNGERAKQLRRFSIATLRGFGVGKRGIEERIQEEAGFLIDALRGTHGANIDPTFFLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSTGQLYEMFSSVMKHLPGPQQQAFKELQGLEDFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLVMTTLNLFFAGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYTEAVIHEIQRFGDMLPMGLAHRVNKDTKFRDFFLPKGTEVFPMLGSVLRDPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELFLFFTTIMQNFRFKSPQSPKDIDVSPKHVGFATIPRNYTMSFLPR
Specificity
CYP2A13 - cytochrome P450, family 2, subfamily A, polypeptide 13,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CYP2A13
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CYP2A13 Antibody

  • CPAD
  • CYP2A
  • CYPIIA13
  • cytochrome P450 2A13
  • cytochrome P450, family 2, subfamily A, polypeptide 13
  • cytochrome P450, subfamily IIA (phenobarbital-inducible), polypeptide 13
  • EC 1.14.14.1

Background

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. Although its endogenous substrate has not been determined, it is known to metabolize 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone, a major nitrosamine specific to tobacco. This gene is part of a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01437
Species: Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-37502
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-01800
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-85367
Species: Hu, Mu, Rt, V-Vi
Applications: IHC, IHC-P, WB
H00001556-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-01397
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-02563
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-74398
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67020
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-92808
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-10546
Species: Hu
Applications: WB
H00004595-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, WB
NBP2-92810
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00001549-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-50209
Species: Hu
Applications: ELISA, IHC, WB
NBP2-24722
Species: Hu
Applications: IHC, IHC-P, In vitro, WB
PP-N4111-00
Species: Hu
Applications: IHC, IP, WB
H00001553-B01P
Species: Hu
Applications: WB

Publications for CYP2A13 Antibody (H00001553-B01P) (0)

There are no publications for CYP2A13 Antibody (H00001553-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP2A13 Antibody (H00001553-B01P) (0)

There are no reviews for CYP2A13 Antibody (H00001553-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYP2A13 Antibody (H00001553-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CYP2A13 Products

Bioinformatics Tool for CYP2A13 Antibody (H00001553-B01P)

Discover related pathways, diseases and genes to CYP2A13 Antibody (H00001553-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP2A13 Antibody (H00001553-B01P)

Discover more about diseases related to CYP2A13 Antibody (H00001553-B01P).
 

Pathways for CYP2A13 Antibody (H00001553-B01P)

View related products by pathway.

PTMs for CYP2A13 Antibody (H00001553-B01P)

Learn more about PTMs related to CYP2A13 Antibody (H00001553-B01P).

Blogs on CYP2A13

There are no specific blogs for CYP2A13, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYP2A13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP2A13
Entrez
Uniprot