Home » CYLC2 » CYLC2 Antibodies » CYLC2 Antibody

CYLC2 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: CYLC2 Antibody [H00001539-B01P] - Analysis of CYLC2 expression in human spleen.
Western Blot: CYLC2 Antibody [H00001539-B01P] - Analysis of CYLC2 expression in human spleen.
Western Blot: CYLC2 Antibody [H00001539-B01P] - Analysis of CYLC2 expression in transfected 293T cell line by CYLC2 polyclonal antibody. Lane 1: CYLC2 transfected lysate(39.10 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CYLC2 Antibody Summary

Immunogen
CYLC2 (NP_001331.1, 1 a.a. - 348 a.a.) full-length human protein. MSLPRFQRVNFGPYDNYIPVSELSKKSWNQQHFALLFPKPQRPGTKRRSKPSQIRDNTVSIIDEEQLRGDRRQPLWMYRSLMRISERPSVYLAARRQPLKPTRTVEVDSKAAEIGKKGEDKTTQKDTTDSESELKQGKKDSKKGKDIEKGKEEKLDAKKDSKKGKKDAEKGKDSATESEDEKGGAKKDNKKDKKDSNKGKDSATESEGEKGGTEKDSKKGKKDSKKGKDSAIELQAVKADEKKDEDGKKDANKGDESKDAKKDAKEIKKGKKDKKKPSSTDSDSKDDVKKESKKDATKDAKKVAKKDTEKESADSKKDAKKNAKKDAKKDAKKNAKKDEKKDAKKKGK
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CYLC2
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CYLC2 Antibody

  • CYL2
  • Cylicin II
  • cylicin, basic protein of sperm head cytoskeleton 2
  • cylicin-2
  • MGC129591
  • Multiple-band polypeptide II

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Cylicin 1 Antibody
NBP2-56428
Immunohistochemistry-Paraffin: Cylicin 1 Antibody [NBP2-56428] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: Cylicin 1 Antibody [NBP2-56428] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: Cylicin 1 Antibody [NBP2-56428] - Staining in human testis and endometrium tissues using anti-CYLC1 antibody. Corresponding CYLC1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
Recombinant Human
Calicin GST (N-Term) ...
H00000881-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
Cyclin D2 Antibody
NBP3-13225
Western Blot: Cyclin D2 Antibody [NBP3-13225] - Whole cell extract (30 ug) was separated by 12% SDS-PAGE, and the membrane was blotted with Cyclin D2 antibody (NBP3-13225) diluted at 1:1000.
Immunohistochemistry-Paraffin: Cyclin D2 Antibody [NBP3-13225] - Cyclin D2 antibody detects Cyclin D2 protein at cytoplasm in human cervical carcinoma by immunohistochemical analysis. Sample: Paraffin-embedded human cervical carcinoma. Cyclin D2 antibody (NBP3-13225) diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Immunocytochemistry/Immunofluorescence: Cyclin D2 Antibody [NBP3-13225] - Cyclin D2 antibody detects Cyclin D2 protein at cytoplasm and nucleus by immunofluorescent analysis. Sample: HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Cyclin D2 protein stained by Cyclin D2 antibody (NBP3-13225) diluted at 1:500. Blue: Hoechst 33342 staining.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Tripeptidyl
peptidase II Antibody
NBP1-86022
Immunohistochemistry-Paraffin: Tripeptidyl peptidase II Antibody [NBP1-86022] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Western Blot: Tripeptidyl peptidase II Antibody [NBP1-86022] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Western Blot: Tripeptidyl peptidase II Antibody [NBP1-86022] - Analysis in human cell line Jurkat.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
ACRBP Antibody
NBP1-85407
Immunocytochemistry/Immunofluorescence: ACRBP Antibody [NBP1-85407] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ACRBP Antibody [NBP1-85407] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: ACRBP Antibody [NBP1-85407] - Staining of human testis shows high expression.
(2 Publications)
Species: Hu, Pm, RM
Applications: ICC/IF, IHC, IHC-P, WB
IZUMO1 Antibody
NBP1-83086
Western Blot: IZUMO1 Antibody [NBP1-83086] - Analysis in control (vector only transfected HEK293T lysate) and IZUMO1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Analysis in human testis and liver tissues. Corresponding IZUMO1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Staining of human cerebral cortex shows no positivity in neurons as expected.
(1 Review)
(1 Publication)
Species: Hu, Po
Applications: ICC, IHC, IHC-P, WB
LMOD1 Antibody
NBP1-89396
Immunocytochemistry/Immunofluorescence: LMOD1 Antibody [NBP1-89396] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LMOD1 Antibody [NBP1-89396] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: LMOD1 Antibody [NBP1-89396] - Staining of human prostate shows high expression.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ZPBP Antibody
NBP2-93039
Western Blot: ZPBP Antibody [NBP2-93039] - Analysis of extracts of Mouse brain, using ZPBP at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time:
Immunohistochemistry: ZPBP Antibody [NBP2-93039] - Analysis of mouse testis using ZPBP at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry: ZPBP Antibody [NBP2-93039] - Analysis of rat testis using ZPBP at dilution of 1:100. Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Progesterone
R/NR3C3 Antibody [Unc ...
AF5415
Progesterone R/NR3C3 was detected in immersion fixed T47D human breast cancer cell line using Sheep Anti-Human Progesterone R/NR3C3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5415) at 1.7 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Progesterone R/NR3C3 was detected in immersion fixed paraffin-embedded sections of human prostate cancer tissue using Sheep Anti-Human Progesterone R/NR3C3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5415) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to nuclei. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of T47D human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Progesterone R/NR3C3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5415) followed by HRP‑conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). Specific bands were detected for PR-A and PR-B at approximately 90 and 118 kDa, respectively (as indicated). This experiment was conducted using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
CATSPER4 Antibody
NBP1-91751
Immunohistochemistry-Paraffin: CATSPER4 Antibody [NBP1-91751] - Staining in human testis and endometrium tissues using anti-CATSPER4 antibody. Corresponding CATSPER4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CATSPER4 Antibody [NBP1-91751] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: CATSPER4 Antibody [NBP1-91751] - Staining of human testis shows strong cytoplasmic positivity in spermatids.
Species: Hu
Applications: IHC, IHC-P
U11/U12-35K
Antibody
NBP2-20774
Immunocytochemistry/Immunofluorescence: U11/U12-35K Antibody [NBP2-20774] - U11/U12-35K antibody detects U11/U12-35K protein at nucleus by immunofluorescent analysis. Sample: U87-MG cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: U11/U12-35K protein stained by U11/U12-35K antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Western Blot: U11/U12-35K Antibody [NBP2-20774] - Sample (30 ug of whole cell lysate) A: U87-MG 12% SDS PAGE gel, diluted at 1:1000.
Western Blot: U11/U12-35K Antibody [NBP2-20774] - Sample (50 ug of whole cell lysate) A: Mouse Brain, 12% SDS PAGE gel, diluted at 1:1000.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
BBS9 Antibody
NBP1-88927
Immunohistochemistry-Paraffin: BBS9 Antibody [NBP1-88927] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
IGFBP-2 [Biotin]
DY674
(11 Publications)
Species: Hu
Applications: ELISA
DIO3 Antibody -
BSA Free
NBP1-05767
Flow Cytometry: DIO3 Antibody [NBP1-05767] - Analysis using the Biotin conjugate of NBP1-05767. Dio3 staining of mouse hepatic stellate cell cultured for 7 days. Image from verified customer review.
Western Blot: DIO3 Antibody [NBP1-05767] - Detection of Dio3 in rabbit brain whole cell homogenate. Photo courtesy of product review by verified customer.
Western Blot: DIO3 Antibody [NBP1-05767] - Detection of Dio3 in rat placenta.
(2 Reviews)
(14 Publications)
Species: Ha, Hu, Mu, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
EYS/RP25 Antibody
NBP1-90038
Immunocytochemistry/Immunofluorescence: EYS/RP25 Antibody [NBP1-90038] - Wild-type & pomgnt1sny7 mutant retinas: EYS/RP25 (green) & acetylated alpha-tubulin (red). (A,E) Wild-type retina 2-mpf. (C,G) Wild-type retina 6-mpf. (B, F) Homozygous pomgnt1sny7 mutant retina 2-mpf. (D,H) Homozygous pomgnt1sny7 mutant retina 6-mpf. (I,J) Counting EYS-acetylated alpha-tubulin from outer nuclear layer to retinal pigment epithelium (RPE) 2-mpf and 6-mpf retina. (K,L) Ratio of EYS/RP25 & acetylated alpha-tubulin-labeled axonemes in rods & cones 2-mpf (M,N). Ratio of EYS/RP25 and acetylated alpha-tubulin acetylated alpha-tubulin-labeled axoneme in rods & cones 6-mpf (O,Q). Total EYS/RP25 immunoreactivity 2-mpf & 6-mpf. (P,R) Total EYS/RP25 in wild-type/heterozygous & mutant fish 2-mpf, 6-mpf. Scale bar: 5 um (A-D); 2.5 um (E-H). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-020-64752-4), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: EYS/RP25 Antibody [NBP1-90038] - Staining of human lung shows moderate cytoplasmic positivity in lung macrophages.
(9 Publications)
Species: Hu, Ze
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Cyclin D1 Antibody
(SPM587)
NBP2-32840
Western Blot: Cyclin D1 Antibody (SPM587) [NBP2-32840] - HELLS expression and protein levels are modulated with YAP1/TEAD inhibition downstream of SHH signaling. Western blot showing protein levels of HELLS, cleaved caspase 3 (CC3), and Cyclin D1 in verteporfin treated CGNPs. Blot is representative of three replicates. Full-length blots are presented in Supplementary Fig. S4. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-019-50088-1), licensed under a CC-BY licence.
Flow Cytometry: Cyclin D1 Antibody (SPM587) [NBP2-32840] - Flow Cytometric analysis of human Cyclin D1 on Jurkat cells. Black: cells alone; Green: Isotype Control; Red: PE-labeled Cyclin D1 Monoclonal Antibody (SPM587).
Flow Cytometry: Cyclin D1 Antibody (SPM587) [NBP2-32840] - Flow Cytometric analysis of human Cyclin D1 on MCF-7 cells. Black: cells alone; Green: Isotype Control; Red: PE-labeled Cyclin D1 Monoclonal Antibody (SPM587).
(1 Review)
(8 Publications)
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Acrosin Antibody
NBP2-14260
Immunohistochemistry-Paraffin: Acrosin Antibody [NBP2-14260] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: Acrosin Antibody [NBP2-14260] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: Acrosin Antibody [NBP2-14260] - Staining in human testis and prostate tissues using anti-ACR antibody. Corresponding ACR RNA-seq data are presented for the same tissues.
(7 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
SP17 Antibody
NBP1-85409
Immunohistochemistry-Paraffin: SP17 Antibody [NBP1-85409] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: SP17 Antibody [NBP1-85409] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: SP17 Antibody [NBP1-85409] - Staining in human testis and endometrium tissues using anti-SPA17 antibody. Corresponding SPA17 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for CYLC2 Antibody (H00001539-B01P) (0)

There are no publications for CYLC2 Antibody (H00001539-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYLC2 Antibody (H00001539-B01P) (0)

There are no reviews for CYLC2 Antibody (H00001539-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYLC2 Antibody (H00001539-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CYLC2 Products

Bioinformatics Tool for CYLC2 Antibody (H00001539-B01P)

Discover related pathways, diseases and genes to CYLC2 Antibody (H00001539-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYLC2 Antibody (H00001539-B01P)

Discover more about diseases related to CYLC2 Antibody (H00001539-B01P).
 

Pathways for CYLC2 Antibody (H00001539-B01P)

View related products by pathway.

Blogs on CYLC2

There are no specific blogs for CYLC2, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYLC2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CYLC2
Uniprot