EYS/RP25 Antibody

Images

 
Immunohistochemistry-Paraffin: EYS/RP25 Antibody [NBP1-90038] - Staining of human lung shows moderate cytoplasmic positivity in lung macrophages.

Product Details

Summary
Reactivity Hu, ZeSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EYS/RP25 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CECTSGWTGQNCSEEINECDSDPCMNGGLCHESTIPGQFVCLCPPLYTGQFCHQRYNLCDLLHNPCR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EYS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 27737822).
Control Peptide
EYS/RP25 Protein (NBP1-90038PEP)
Publications
Read Publication using
NBP1-90038 in the following applications:

Reactivity Notes

Zebrafish reactivity reported in scientific literature (PMID: 27737822).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EYS/RP25 Antibody

  • C6orf178
  • C6orf179
  • C6orf180
  • dJ22I17.2
  • dJ303F19.1
  • EGFL10
  • EGFL11
  • EGF-like-domain, multiple 10
  • EGF-like-domain, multiple 11
  • eyes shut homolog (Drosophila)
  • protein spacemaker homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81637
Species: Hu
Applications: WB, IHC, IHC-P
PP-H7223-00
Species: Hu
Applications: WB, IHC, DirELISA
NBP2-56113
Species: Hu
Applications: IHC-P
AF591
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP1-30032
Species: Hu, Mu, Bv, Xp
Applications: WB, IHC, IHC-Fr
NBP1-87312
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84412
Species: Hu
Applications: IHC, IHC-P
NBP1-92335
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-78444
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-33569
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
H00006785-Q01
Species: Hu
NLS1049
Species: Hu, Eq, Mk, Pm
Applications: IHC-P, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB100-2911
Species: Hu
Applications: WB, ICC/IF
NBP1-71688
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF
AF550
Species: Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)

Publications for EYS/RP25 Antibody (NBP1-90038)(1)

We have publications tested in 1 confirmed species: Zebrafish.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Zebrafish
(1)
All Species

Reviews for EYS/RP25 Antibody (NBP1-90038) (0)

There are no reviews for EYS/RP25 Antibody (NBP1-90038). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for EYS/RP25 Antibody (NBP1-90038) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EYS/RP25 Products

Bioinformatics Tool for EYS/RP25 Antibody (NBP1-90038)

Discover related pathways, diseases and genes to EYS/RP25 Antibody (NBP1-90038). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EYS/RP25 Antibody (NBP1-90038)

Discover more about diseases related to EYS/RP25 Antibody (NBP1-90038).
 

Pathways for EYS/RP25 Antibody (NBP1-90038)

View related products by pathway.

Blogs on EYS/RP25

There are no specific blogs for EYS/RP25, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EYS/RP25 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EYS