Cyclophilin 40 Antibody


Western Blot: Cyclophilin 40 Antibody [NBP1-85364] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: Cyclophilin 40 Antibody [NBP1-85364] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus, nucleoli & cytosol.
Immunohistochemistry-Paraffin: Cyclophilin 40 Antibody [NBP1-85364] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Cyclophilin 40 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: IDSCLEALELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKVKQKIKAQKDKEKAV
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Cyclophilin 40 Protein (NBP1-85364PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Cyclophilin 40 Antibody

  • 40 kDa peptidyl-prolyl cis-trans isomerase D
  • 40 kDa peptidyl-prolyl cis-trans isomerase
  • cyclophilin D
  • cyclophilin-40
  • Cyclophilin-related protein
  • CYP40
  • CYP-40cyclophilin 40
  • CYPD
  • EC
  • MGC33096
  • peptidyl-prolyl cis-trans isomerase D
  • peptidylprolyl isomerase D (cyclophilin D)
  • peptidylprolyl isomerase D
  • PPIase D
  • Rotamase D


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, WB
Species: Bv, Ch, Hu, Mu, Pm, Rb, Rt
Applications: IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Fi, Hu, Mu, Rt
Applications: ELISA, IHC, KD, WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Cyclophilin 40 Antibody (NBP1-85364) (0)

There are no publications for Cyclophilin 40 Antibody (NBP1-85364).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cyclophilin 40 Antibody (NBP1-85364) (0)

There are no reviews for Cyclophilin 40 Antibody (NBP1-85364). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cyclophilin 40 Antibody (NBP1-85364) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Cyclophilin 40 Products

Bioinformatics Tool for Cyclophilin 40 Antibody (NBP1-85364)

Discover related pathways, diseases and genes to Cyclophilin 40 Antibody (NBP1-85364). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cyclophilin 40 Antibody (NBP1-85364)

Discover more about diseases related to Cyclophilin 40 Antibody (NBP1-85364).

Pathways for Cyclophilin 40 Antibody (NBP1-85364)

View related products by pathway.

PTMs for Cyclophilin 40 Antibody (NBP1-85364)

Learn more about PTMs related to Cyclophilin 40 Antibody (NBP1-85364).

Research Areas for Cyclophilin 40 Antibody (NBP1-85364)

Find related products by research area.

Blogs on Cyclophilin 40

There are no specific blogs for Cyclophilin 40, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Cyclophilin 40 Antibody and receive a gift card or discount.


Gene Symbol PPID