Recombinant Human CXXC5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CXXC5 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 121-220 of Human CXXC5 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LAAAMAVDKSNPTSKHKSGAVASLLSKAERATELAAEGQLTLQQFAQSTEMLKRVVQEHLPLMSEAGAGLPDMEAVAGAEALNGQSDFPYLGAFPINPGL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CXXC5
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CXXC5 Protein

  • CF5
  • CXXC finger 5 protein
  • CXXC finger 5
  • CXXC finger protein 5
  • CXXC-type zinc finger protein 5
  • HSPC195
  • Putative MAPK-activating protein PM08
  • Putative NF-kappa-B-activating protein 102
  • retinoid-inducible nuclear factor
  • RINF
  • WID
  • WT1-induced Inhibitor of Dishevelled

Background

CXXC5 - CXXC finger 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76491
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
H00171023-M05
Species: Hu
Applications: WB, ELISA
NB100-1268
Species: Hu, Ze
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
AF6347
Species: Hu
Applications: WB
NBP1-85432
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4979
Species: Hu
Applications: WB
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-88888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89827
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NB100-55256
Species: Hu
Applications: WB, IHC-P, IP
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF8107
Species: Hu
Applications: WB, IHC
H00000537-M01
Species: Hu, Rt
Applications: WB, ELISA
AF3287
Species: Hu, Mu, Rt
Applications: WB

Publications for CXXC5 Partial Recombinant Protein (H00051523-Q01) (0)

There are no publications for CXXC5 Partial Recombinant Protein (H00051523-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CXXC5 Partial Recombinant Protein (H00051523-Q01) (0)

There are no reviews for CXXC5 Partial Recombinant Protein (H00051523-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CXXC5 Partial Recombinant Protein (H00051523-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CXXC5 Products

Bioinformatics Tool for CXXC5 Partial Recombinant Protein (H00051523-Q01)

Discover related pathways, diseases and genes to CXXC5 Partial Recombinant Protein (H00051523-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CXXC5 Partial Recombinant Protein (H00051523-Q01)

Discover more about diseases related to CXXC5 Partial Recombinant Protein (H00051523-Q01).
 

Pathways for CXXC5 Partial Recombinant Protein (H00051523-Q01)

View related products by pathway.

PTMs for CXXC5 Partial Recombinant Protein (H00051523-Q01)

Learn more about PTMs related to CXXC5 Partial Recombinant Protein (H00051523-Q01).
 

Research Areas for CXXC5 Partial Recombinant Protein (H00051523-Q01)

Find related products by research area.

Blogs on CXXC5

There are no specific blogs for CXXC5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ATM Antibody
NB100-104
CXXC5 Antibody
NBP1-76513

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CXXC5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CXXC5