CXCL7/NAP-2 Antibody

Images

 
Western Blot: CXCL7/NAP-2 Antibody [H00005473-B01P] - Analysis of PPBP expression in human spleen.
Western Blot: CXCL7/NAP-2 Antibody [H00005473-B01P] - Analysis of PPBP expression in transfected 293T cell line by PPBP polyclonal antibody. Lane 1: PPBP transfected lysate(14.08 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CXCL7/NAP-2 Antibody Summary

Immunogen
PPBP (NP_002695.1, 1 a.a. - 128 a.a.) full-length human protein. MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
Specificity
PPBP - pro-platelet basic protein (chemokine (C-X-C motif) ligand 7),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
PPBP
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CXCL7/NAP-2 Antibody

  • Beta-TG
  • connective tissue-activating peptide III
  • CTAP III
  • CTAP3CTAP-III
  • CTAPIII
  • CXC chemokine ligand 7
  • C-X-C motif chemokine 7
  • CXCL7
  • CXCL7b-TG1
  • LA-PF4
  • LDGFTC1
  • Leukocyte-derived growth factor
  • low-affinity platelet factor IV
  • Macrophage-derived growth factor
  • MDGFTC2
  • NAP2
  • NAP-2
  • NAP-2-L1
  • neutrophil-activating peptide 2
  • neutrophil-activating peptide-2
  • PBPTHBGB
  • platelet basic protein
  • PPBP
  • pro-platelet basic protein (chemokine (C-X-C motif) ligand 7)
  • SCAR10
  • SCYB7beta-thromboglobulin
  • small inducible cytokine B7
  • small inducible cytokine subfamily B, member 7
  • Small-inducible cytokine B7
  • TGB
  • TGB1B-TG1
  • THBGB1
  • thrombocidin 1
  • thrombocidin 2
  • thromboglobulin, beta-1

Background

The protein encoded by this gene is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. It has been shown to stimulate various cellular processes including DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and sythesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by synovial cells. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

795-P4/CF
Species: Hu
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
AF1267
Species: Hu
Applications: WB, IP, Neut
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC
46420002
Species: Hu
Applications: WB, ELISA
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB331
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
H00005473-B01P
Species: Hu
Applications: WB

Publications for CXCL7/NAP-2 Antibody (H00005473-B01P) (0)

There are no publications for CXCL7/NAP-2 Antibody (H00005473-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CXCL7/NAP-2 Antibody (H00005473-B01P) (0)

There are no reviews for CXCL7/NAP-2 Antibody (H00005473-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CXCL7/NAP-2 Antibody (H00005473-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CXCL7/NAP-2 Products

Bioinformatics Tool for CXCL7/NAP-2 Antibody (H00005473-B01P)

Discover related pathways, diseases and genes to CXCL7/NAP-2 Antibody (H00005473-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CXCL7/NAP-2 Antibody (H00005473-B01P)

Discover more about diseases related to CXCL7/NAP-2 Antibody (H00005473-B01P).
 

Pathways for CXCL7/NAP-2 Antibody (H00005473-B01P)

View related products by pathway.

PTMs for CXCL7/NAP-2 Antibody (H00005473-B01P)

Learn more about PTMs related to CXCL7/NAP-2 Antibody (H00005473-B01P).
 

Research Areas for CXCL7/NAP-2 Antibody (H00005473-B01P)

Find related products by research area.

Blogs on CXCL7/NAP-2

There are no specific blogs for CXCL7/NAP-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CXCL7/NAP-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPBP
Entrez
Uniprot