Recombinant Human CXCL2/GRO beta/MIP-2/CINC-3 Protein Summary
| Description |
A recombinant protein with His-Flag-StrepII tag at N-terminus corresponding to the amino acids 1-73 of Purified CXCL2 Source: Human Amino Acid Sequence:APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN |
| Protein/Peptide Type |
Recombinant Protein |
| Gene |
CXCL2 |
Applications/Dilutions
| Dilutions |
- ELISA
- SDS-Page
- Western Blot
|
| Application Notes |
This product is useful for PI,SDS-PAGE,ELISA,WB. |
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Preservative |
No Preservative |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human CXCL2/GRO beta/MIP-2/CINC-3 Protein
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Bv, Ca, Hu, Pm, Mu, Rb
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu
Applications: BA
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB, ELISA, PAGE
Publications for CXCL2/GRO beta/MIP-2/CINC-3 Recombinant Protein (H00002920-H01) (0)
There are no publications for CXCL2/GRO beta/MIP-2/CINC-3 Recombinant Protein (H00002920-H01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CXCL2/GRO beta/MIP-2/CINC-3 Recombinant Protein (H00002920-H01) (0)
There are no reviews for CXCL2/GRO beta/MIP-2/CINC-3 Recombinant Protein (H00002920-H01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CXCL2/GRO beta/MIP-2/CINC-3 Recombinant Protein (H00002920-H01) (0)
Additional CXCL2/GRO beta/MIP-2/CINC-3 Products
Research Areas for CXCL2/GRO beta/MIP-2/CINC-3 Recombinant Protein (H00002920-H01)
Find related products by research area.
|
Blogs on CXCL2/GRO beta/MIP-2/CINC-3