CXCL11/I-TAC Antibody

Images

 
Western Blot: CXCL11/I-TAC Antibody [H00006373-D01P] - Analysis of CXCL11 expression in NIH/3T3.
Western Blot: CXCL11/I-TAC Antibody [H00006373-D01P] - Analysis of CXCL11 expression in Jurkat.
Western Blot: CXCL11/I-TAC Antibody [H00006373-D01P] - Analysis of CXCL11 expression in transfected 293T cell line by CXCL11 polyclonal antibody.Lane 1: CXCL11 transfected lysate(10.40 KDa).Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CXCL11/I-TAC Antibody Summary

Immunogen
CXCL11 (NP_005400.1, 1 a.a. - 94 a.a.) full-length human protein. MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Specificity
CXCL11 - chemokine (C-X-C motif) ligand 11,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CXCL11
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.Use in Immunohistochemistry reported in scientific literature (PMID 28239742).
Publications
Read Publication using
H00006373-D01P in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CXCL11/I-TAC Antibody

  • beta-R1
  • b-R1
  • chemokine (C-X-C motif) ligand 11
  • CXCL11
  • H174
  • H174IP9
  • Interferon gamma-inducible protein 9
  • Interferon-inducible T-cell alpha chemoattractant
  • IP-9member 11
  • ITAC
  • I-TAC
  • I-TACMGC102770
  • SCYB9B
  • small inducible cytokine subfamily B (Cys-X-Cys), member 9B
  • Small-inducible cytokine B11

Background

Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC. This gene is a CXC member of the chemokine superfamily. Its encoded protein induces a chemotactic response in activated T-cells and is the dominant ligand for CXC receptor-3. The gene encoding this protein contains 4 exons and at least three polyadenylation signals which might reflect cell-specific regulation of expression. IFN-gamma is a potent inducer of transcription of this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB160
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
MAB182
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
MAB172
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
795-P4/CF
Species: Hu
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-24779
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P
H00006373-D01P
Species: Hu, Mu
Applications: WB, IHC

Publications for CXCL11/I-TAC Antibody (H00006373-D01P)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for CXCL11/I-TAC Antibody (H00006373-D01P) (0)

There are no reviews for CXCL11/I-TAC Antibody (H00006373-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CXCL11/I-TAC Antibody (H00006373-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CXCL11/I-TAC Products

Bioinformatics Tool for CXCL11/I-TAC Antibody (H00006373-D01P)

Discover related pathways, diseases and genes to CXCL11/I-TAC Antibody (H00006373-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CXCL11/I-TAC Antibody (H00006373-D01P)

Discover more about diseases related to CXCL11/I-TAC Antibody (H00006373-D01P).
 

Pathways for CXCL11/I-TAC Antibody (H00006373-D01P)

View related products by pathway.

PTMs for CXCL11/I-TAC Antibody (H00006373-D01P)

Learn more about PTMs related to CXCL11/I-TAC Antibody (H00006373-D01P).
 

Research Areas for CXCL11/I-TAC Antibody (H00006373-D01P)

Find related products by research area.

Blogs on CXCL11/I-TAC

There are no specific blogs for CXCL11/I-TAC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CXCL11/I-TAC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CXCL11
Entrez
Uniprot