CXCL11/I-TAC Antibody

Western Blot: CXCL11/I-TAC Antibody [H00006373-D01P] - Analysis of CXCL11 expression in NIH/3T3.

Western Blot: CXCL11/I-TAC Antibody [H00006373-D01P] - Analysis of CXCL11 expression in Jurkat.

Western Blot: CXCL11/I-TAC Antibody [H00006373-D01P] - Analysis of CXCL11 expression in transfected 293T cell line by CXCL11 polyclonal antibody.Lane 1: CXCL11 transfected lysate(10.40 KDa).Lane 2: Non-transfected lysate.

Product Discontinued

CXCL11/I-TAC Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: CXCL11 (NP_005400.1, 1 a.a. - 94 a.a.) full-length human protein. MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
• Specificity: CXCL11 - chemokine (C-X-C motif) ligand 11,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CXCL11
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.Use in Immunohistochemistry reported in scientific literature (PMID 28239742).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CXCL11/I-TAC Antibody

• beta-R1
• b-R1
• chemokine (C-X-C motif) ligand 11
• CXCL11
• H174
• H174IP9
• Interferon gamma-inducible protein 9
• Interferon-inducible T-cell alpha chemoattractant
• IP-9member 11
• ITAC
• I-TAC
• I-TACMGC102770
• SCYB9B
• small inducible cytokine subfamily B (Cys-X-Cys), member 9B
• Small-inducible cytokine B11

Background

Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC. This gene is a CXC member of the chemokine superfamily. Its encoded protein induces a chemotactic response in activated T-cells and is the dominant ligand for CXC receptor-3. The gene encoding this protein contains 4 exons and at least three polyadenylation signals which might reflect cell-specific regulation of expression. IFN-gamma is a potent inducer of transcription of this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CXCL11/I-TAC Antibody (H00006373-D01P)(1)

Publication using H00006373-D01P

• Gu HQ, Zhang ZB, Zhang JW et al. The role of the SDF-1/ CXCR7 axis on the growth and invasion ability of endometrial cancer cells. Arch. Gynecol. Obstet. 2017-04-01 [PMID: 28239742] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: CXCL11
• Entrez:
  • 6373(Human)
• Uniprot:
  • NP_005400.1(Human)