Recombinant Human CXCL1/GRO alpha/KC/CINC-1 Protein

Product Discontinued

Recombinant Human CXCL1/GRO alpha/KC/CINC-1 Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-107 of Human CXCL1 full-length ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

• Protein/Peptide Type: Recombinant Protein
• Gene: CXCL1

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CXCL1/GRO alpha/KC/CINC-1 Protein

• CINC1
• CINC-1
• CXCL1
• FSP
• GRO alpha
• GRO1
• GROa
• KC
• MGSA
• MGSA-a
• MGSA-alpha
• NAP-3
• SCYB1

Background

Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC, based on the arrangement of the first 2 of the 4 conserved cysteine residues; the 2 cysteines are separated by a single amino acid in CXC chemokines and are adjacent in CC chemokines. CXC chemokines are further subdivided into ELR and non-ELR types based on the presence or absence of a glu-leu-arg sequence adjacent and N terminal to the CXC motif.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CXCL1