Recombinant Human CUTL2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CUTL2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 121-220 of Human CUTL2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:FDPSGQPRRDLHTSWKRNPELLSPKEQREGTSPAGPTLTEGSRLPGIPGKALLTETLLQRNEAEKQKGLQEVQITLAARLGEAEEKIKVLHSALKATQAE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CUX2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CUTL2 Protein

  • CDP2
  • CUTL2
  • cut-like 2 (Drosophila)
  • cut-like homeobox 2
  • homeobox protein cut-like 2
  • Homeobox protein cux-2
  • KIAA0293

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-2596
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow
NBP1-87857
Species: Hu
Applications: WB, IHC, IHC-P
AF2156
Species: Hu, Mu
Applications: WB, IHC
26260002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF1555
Species: Hu
Applications: WB
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF2746
Species: Hu, Mu
Applications: WB, ICC
NBP1-81872
Species: Hu
Applications: IHC, IHC-P
MAB7557
Species: Hu
Applications: WB, IHC
NB100-1566
Species: Hu
Applications: WB, IP
NBP1-28728
Species: Hu
Applications: IP (-), WB, IHC
NBP2-00622
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for CUTL2 Partial Recombinant Protein (H00023316-Q01) (0)

There are no publications for CUTL2 Partial Recombinant Protein (H00023316-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CUTL2 Partial Recombinant Protein (H00023316-Q01) (0)

There are no reviews for CUTL2 Partial Recombinant Protein (H00023316-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CUTL2 Partial Recombinant Protein (H00023316-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CUTL2 Products

Bioinformatics Tool for CUTL2 Partial Recombinant Protein (H00023316-Q01)

Discover related pathways, diseases and genes to CUTL2 Partial Recombinant Protein (H00023316-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CUTL2 Partial Recombinant Protein (H00023316-Q01)

Discover more about diseases related to CUTL2 Partial Recombinant Protein (H00023316-Q01).
 

Pathways for CUTL2 Partial Recombinant Protein (H00023316-Q01)

View related products by pathway.

PTMs for CUTL2 Partial Recombinant Protein (H00023316-Q01)

Learn more about PTMs related to CUTL2 Partial Recombinant Protein (H00023316-Q01).

Blogs on CUTL2

There are no specific blogs for CUTL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CUTL2 Antibody
NBP1-91815

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CUTL2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CUX2