CutA Antibody - BSA Free

Staining of human adrenal gland shows strong cytoplasmic and nunclear positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CutA Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CutA Antibody - BSA Free (NBP3-24769) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein CutA using the following amino acid sequence: LLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQI
• Predicted Species: Mouse (91%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CUTA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, we recommend using Heat-Induced Epitope Retrieval (HIER) with a pH level of 6. This optimized retrieval method ensures the best results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CutA Antibody - BSA Free

• Acetylcholinesterase-associated proteinBrain acetylcholinesterase putative membrane anchor
• ACHAP
• C6orf82
• chromosome 6 open reading frame 82
• cutA divalent cation tolerance homolog (E. coli)
• divalent cation tolerant protein CUTA
• MGC111154
• protein CutA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CUTA