CutA Antibody


Western Blot: CutA Antibody [NBP1-59527] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

CutA Antibody Summary

Synthetic peptides corresponding to CUTA(cutA divalent cation tolerance homolog (E. coli)) The peptide sequence was selected from the middle region of CUTA. Peptide sequence AFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CUTA and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CutA Antibody

  • Acetylcholinesterase-associated proteinBrain acetylcholinesterase putative membrane anchor
  • C6orf82
  • chromosome 6 open reading frame 82
  • cutA divalent cation tolerance homolog (E. coli)
  • divalent cation tolerant protein CUTA
  • MGC111154
  • protein CutA


CUTA may forms part of a complex of membrane proteins attached to acetylcholinesterase (AChE).


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Species: Mu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP, PLA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ELISA

Publications for CutA Antibody (NBP1-59527) (0)

There are no publications for CutA Antibody (NBP1-59527).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CutA Antibody (NBP1-59527) (0)

There are no reviews for CutA Antibody (NBP1-59527). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CutA Antibody (NBP1-59527) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CutA Products

Bioinformatics Tool for CutA Antibody (NBP1-59527)

Discover related pathways, diseases and genes to CutA Antibody (NBP1-59527). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CutA Antibody (NBP1-59527)

Discover more about diseases related to CutA Antibody (NBP1-59527).

Pathways for CutA Antibody (NBP1-59527)

View related products by pathway.

PTMs for CutA Antibody (NBP1-59527)

Learn more about PTMs related to CutA Antibody (NBP1-59527).

Blogs on CutA

There are no specific blogs for CutA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CutA Antibody and receive a gift card or discount.


Gene Symbol CUTA