CUGBP2 Antibody - BSA Free

Western Blot: CUGBP2 Antibody [NBP1-57376] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml

Immunohistochemistry: CUGBP2 Antibody [NBP1-57376] - Paraffin Embedded Tissue: Human Heart Cellular Data: Myocardial cells Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X

Western Blot: CUGBP2 Antibody [NBP1-57376] - Reccomended Titration: 1.25 ug/ml ELISA Titer: 1:312500 Positive Control: Jurkat cell lysate CELF2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

Immunohistochemistry: CUGBP2 Antibody [NBP1-57376] - Paraffin Embedded Tissue: Human alveolar cell Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

CUGBP2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to CUGBP2 (CUG triplet repeat, RNA binding protein 2) The peptide sequence was selected from the N terminal of CUGBP2. Peptide sequence VYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHP. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CELF2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for CUGBP2 Antibody - BSA Free

• BRUNOL3ELAV-type RNA-binding protein 3
• Bruno-like protein 3
• CELF-2
• CUG triplet repeat RNA-binding protein 2
• CUG triplet repeat, RNA binding protein 2
• CUG triplet repeat, RNA-binding protein 2
• CUG-BP- and ETR-3-like factor 2
• CUGBP Elav-like family member 2
• CUGBP, Elav-like family member 2
• CUG-BP2
• CUGBP2hNAPOR
• Etr-3
• ETR3RNA-binding protein BRUNOL-3
• NAPOR
• NAPOR-2
• Neuroblastoma apoptosis-related RNA-binding protein

Background

Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation.Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CELF2
• Uniprot:
  • Q96RQ6(Human)