CTRP7 Recombinant Protein Antigen

Images

 
There are currently no images for CTRP7 Protein (NBP2-37932PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CTRP7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C1QTNF7.

Source: E. coli

Amino Acid Sequence: GSTVIYLQPEDEVWLEIFFTDQNGLFSDPGWADSLFSGFLLYVDTDYLDSISEDDEL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
C1QTNF7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-37932.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CTRP7 Recombinant Protein Antigen

  • C1q and tumor necrosis factor related protein 7
  • C1qTNF7
  • complement-c1q tumor necrosis factor-related protein 7
  • CTRP7
  • CTRP7complement C1q tumor necrosis factor-related protein 7
  • ZACRP7

Background

Adipose tissue of an organism plays a major role in regulating physiologic and pathologic processes such as metabolism and immunity by producing and secreting a variety of bioactive molecules termed adipokines. One highly conserved family of adipokines is adiponectin/ACRP30 and its structural and functional paralogs, the C1q/tumor necrosis factor-a-related proteins (CTRPs) 1-7. Unlike adiponectin, which is expressed exclusively by differentiated adipocytes, the CTRPs are expressed in a wide variety of tissues. These proteins are thought to act mainly on liver and muscle tissue to control glucose and lipid metabolism. An analysis of the crystal structure of adiponectin revealed a structural and evolutionary link between TNF and C1q-containing proteins, suggesting that these proteins arose from a common ancestral innate immunity gene. Like the other members of the adiponectin and CTRP protein family, the mature CTRP7 is secreted and can be found in the organism's circulatory system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3145
Species: Hu
Applications: WB
NBP1-76671
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
MAB3167
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
NBP1-87492
Species: Hu
Applications: IHC,  IHC-P, WB
DRP300
Species: Hu
Applications: ELISA
DLP00
Species: Hu
Applications: ELISA
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
AF2436
Species: Mu
Applications: WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
H00005706-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
H00010561-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-76633
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF2850
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP2-22127
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF2854
Species: Hu, Mu, Rt
Applications: IHC, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-82778
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
DSE100
Species: Hu
Applications: ELISA
NBP2-37932PEP
Species: Hu
Applications: AC

Publications for CTRP7 Protein (NBP2-37932PEP) (0)

There are no publications for CTRP7 Protein (NBP2-37932PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CTRP7 Protein (NBP2-37932PEP) (0)

There are no reviews for CTRP7 Protein (NBP2-37932PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CTRP7 Protein (NBP2-37932PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CTRP7 Products

Array NBP2-37932PEP

Research Areas for CTRP7 Protein (NBP2-37932PEP)

Find related products by research area.

Blogs on CTRP7

There are no specific blogs for CTRP7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CTRP7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol C1QTNF7