CTP synthase Antibody

Images

 
Western Blot: CTP synthase Antibody [NBP1-52892] - Lanes: 1 : 45ug human capan1 cell lysate Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit HRP Secondary, Antibody Dilution: 1 : 5000 Gene name: CTPS.
Immunohistochemistry-Paraffin: CTP synthase Antibody [NBP1-52892] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.
Western Blot: CTP synthase Antibody [NBP1-52892] - 721B tissue lysate at a concentration of 5ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
1 mg/ml

Order Details

CTP synthase Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to CTPS(CTP synthase) The peptide sequence was selected from the N terminal of CTPS. Peptide sequence SMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELR. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CTPS1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
Theoretical MW
67 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 3
using
NBP1-52892 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
1 mg/ml
Purity
Protein A purified

Alternate Names for CTP synthase Antibody

  • CTP Synthase 1
  • CTP synthase
  • CTP synthetase 1
  • CTPS1
  • cytidine 5-prime triphosphate synthetase
  • cytidine 5'-triphosphate synthetase
  • EC 6.3.4.2
  • GATD5
  • IMD24
  • UTP--ammonia ligase 1

Background

The catalytic conversion of UTP to CTP is accomplished by the enzyme cytidine-5-prime-triphosphate synthetase. The enzyme is important in the biosynthesis of phospholipids and nucleic acids, and plays a key role in cell growth, development, and tumorigenesis.The catalytic conversion of UTP to CTP is accomplished by the enzyme cytidine-5-prime-triphosphate synthetase. The enzyme is important in the biosynthesis of phospholipids and nucleic acids, and plays a key role in cell growth, development, and tumorigenesis. The region to which the CTPS gene has been mapped is the location of breakpoints involved in several tumor types.The catalytic conversion of UTP to CTP is accomplished by the enzyme cytidine-5-prime-triphosphate synthetase. The enzyme is important in the biosynthesis of phospholipids and nucleic acids, and plays a key role in cell growth, development, and tumorigenesis. The region to which the CTPS gene has been mapped is the location of breakpoints involved in several tumor types.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31851
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-52892
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-86055
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85273
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84838
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-69313
Species: Hu
Applications: WB
MAB7670
Species: Hu
Applications: ICC, WB
MAB2294
Species: Hu, Mu
Applications: ICC, IHC, IP, WB
NBP2-39019
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89766
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00001635-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, S-ELISA, WB
NBP1-86616
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-48480
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-82073
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP3-25721
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89519
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PLA, WB
NBP1-52892
Species: Hu
Applications: WB, IHC

Publications for CTP synthase Antibody (NBP1-52892) (0)

There are no publications for CTP synthase Antibody (NBP1-52892).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for CTP synthase Antibody (NBP1-52892) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-52892:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot CTP synthase NBP1-52892
Enlarge
3
reviewed by:
Verified Customer
WB Human 11/30/2015
View

Summary

ApplicationWestern Blot
Sample Testedcell line; MCF10A and MDAMB231
SpeciesHuman
LotQC16217

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CTP synthase Antibody (NBP1-52892) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CTP synthase Products

Diseases for CTP synthase Antibody (NBP1-52892)

Discover more about diseases related to CTP synthase Antibody (NBP1-52892).
 

Pathways for CTP synthase Antibody (NBP1-52892)

View related products by pathway.

PTMs for CTP synthase Antibody (NBP1-52892)

Learn more about PTMs related to CTP synthase Antibody (NBP1-52892).
 

Research Areas for CTP synthase Antibody (NBP1-52892)

Find related products by research area.

Blogs on CTP synthase

There are no specific blogs for CTP synthase, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Verified Customer
11/30/2015
Application: WB
Species: Human

Bioinformatics

Gene Symbol CTPS1
Uniprot