Synthetic peptides corresponding to CTPS(CTP synthase) The peptide sequence was selected from the N terminal of CTPS. Peptide sequence SMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELR. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CTPS1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
This is a rabbit polyclonal antibody against CTPS and was validated on Western Blot and immunohistochemistry-P
Theoretical MW
67 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 3 using NBP1-52892 in the following applications:
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for CTP synthase Antibody
CTP Synthase 1
CTP synthase
CTP synthetase 1
CTPS1
cytidine 5-prime triphosphate synthetase
cytidine 5'-triphosphate synthetase
EC 6.3.4.2
GATD5
IMD24
UTP--ammonia ligase 1
Background
The catalytic conversion of UTP to CTP is accomplished by the enzyme cytidine-5-prime-triphosphate synthetase. The enzyme is important in the biosynthesis of phospholipids and nucleic acids, and plays a key role in cell growth, development, and tumorigenesis.The catalytic conversion of UTP to CTP is accomplished by the enzyme cytidine-5-prime-triphosphate synthetase. The enzyme is important in the biosynthesis of phospholipids and nucleic acids, and plays a key role in cell growth, development, and tumorigenesis. The region to which the CTPS gene has been mapped is the location of breakpoints involved in several tumor types.The catalytic conversion of UTP to CTP is accomplished by the enzyme cytidine-5-prime-triphosphate synthetase. The enzyme is important in the biosynthesis of phospholipids and nucleic acids, and plays a key role in cell growth, development, and tumorigenesis. The region to which the CTPS gene has been mapped is the location of breakpoints involved in several tumor types.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Bioinformatics Tool for CTP synthase Antibody (NBP1-52892)
Discover related pathways, diseases and genes to CTP synthase Antibody (NBP1-52892). Need help?
Read the Bioinformatics Tool Guide for instructions on using this tool.
Diseases for CTP synthase Antibody (NBP1-52892)
Discover more about diseases related to CTP synthase Antibody (NBP1-52892).
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.