CTPS2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CTPS2 Antibody [NBP1-86055] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CTPS2 Antibody [NBP1-86055] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: CTPS2 Antibody [NBP1-86055] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: CTPS2 Antibody [NBP1-86055] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: CTPS2 Antibody [NBP1-86055] - Staining of human placenta shows moderate cytoplasmic positivity in glandular cells.

Analysis in rat cell line NBT-II.

Analysis in human cell line HEK 293.

• Reactivity: Hu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CTPS2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GVCLGMQLAVIEFARNCLNLKDADSTEFRPNAPVPLVIDMPEHNPGNLGGTMRLGIRRTVFKTENSILRKLYGDVPFIEERHRHRFEVNPNLIKQFEQNDLSFVGQDVDGD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CTPS2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CTPS2 Protein (NBP1-86055PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24870241). Mouse (86%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CTPS2 Antibody - BSA Free

• CTP synthase 2
• CTP synthase II
• CTP synthetase 2
• CTP synthetase isoform
• CTP synthetase type 2
• cytidine 5'-triphosphate synthetase 2
• DKFZp686C17207
• EC 6.3.4.2
• FLJ43358
• MGC32997
• UTP--ammonia ligase 2
• UTP-ammonia ligase

Background

The protein encoded by the CTPS2 gene catalyzes the formation of CTP from UTP with the concomitant deamination of glutamineto glutamate. This protein is the rate-limiting enzyme in the synthesis of cytosine nucleotides, which play animportant role in various metabolic processes and provide the precursors necessary for the synthesis of RNA and DNA.Cancer cells that exhibit increased cell proliferation also exhibit an increased activity of this encoded protein.Thus, this protein is an attractive target for selective chemotherapy. Three alternatively spliced transcript variantsencoding the same protein have been described for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CTPS2 Antibody (NBP1-86055)(1)

Publication using NBP1-86055

• Martin E, Palmic N, Sanquer S et al. CTP synthase 1 deficiency in humans reveals its central role in lymphocyte proliferation. Nature 2014-06-12 [PMID: 24870241]

Bioinformatics

• Gene Symbol: CTPS2