CTPS2 Antibody

Images

 
Western Blot: CTPS2 Antibody [NBP1-86055] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: CTPS2 Antibody [NBP1-86055] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: CTPS2 Antibody [NBP1-86055] - Staining of human colon shows strong cytoplasmic and nuclear positivity in glandular cells.
Western Blot: CTPS2 Antibody [NBP1-86055] - Analysis in human cell line HEK 293.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CTPS2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GVCLGMQLAVIEFARNCLNLKDADSTEFRPNAPVPLVIDMPEHNPGNLGGTMRLGIRRTVFKTENSILRKLYGDVPFIEERHRHRFEVNPNLIKQFEQNDLSFVGQDVDGD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CTPS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CTPS2 Protein (NBP1-86055PEP)
Publications
Read Publication using NBP1-86055.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24870241)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CTPS2 Antibody

  • CTP synthase 2
  • CTP synthase II
  • CTP synthetase 2
  • CTP synthetase isoform
  • CTP synthetase type 2
  • cytidine 5'-triphosphate synthetase 2
  • DKFZp686C17207
  • EC 6.3.4.2
  • FLJ43358
  • MGC32997
  • UTP--ammonia ligase 2
  • UTP-ammonia ligase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52892
Species: Hu
Applications: WB, IHC, IHC-P
H00004810-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-46576
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-89091
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20541
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00005545-R02
Species: Hu
NBP1-80891
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87691
Species: Hu
Applications: WB, IHC, IHC-P
AF3320
Species: Hu
Applications: WB, IHC
H00008833-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB120-3535
Species: Hu, Mu, Fi
Applications: WB, ICC/IF, IHC
NBP1-85014
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13199
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86055
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CTPS2 Antibody (NBP1-86055)(1)

Reviews for CTPS2 Antibody (NBP1-86055) (0)

There are no reviews for CTPS2 Antibody (NBP1-86055). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CTPS2 Antibody (NBP1-86055) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CTPS2 Products

Bioinformatics Tool for CTPS2 Antibody (NBP1-86055)

Discover related pathways, diseases and genes to CTPS2 Antibody (NBP1-86055). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CTPS2 Antibody (NBP1-86055)

Discover more about diseases related to CTPS2 Antibody (NBP1-86055).
 

Pathways for CTPS2 Antibody (NBP1-86055)

View related products by pathway.

PTMs for CTPS2 Antibody (NBP1-86055)

Learn more about PTMs related to CTPS2 Antibody (NBP1-86055).
 

Research Areas for CTPS2 Antibody (NBP1-86055)

Find related products by research area.

Blogs on CTPS2

There are no specific blogs for CTPS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CTPS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTPS2