CTP synthase Antibody (9T4J2)

Western Blot: CTP synthase Antibody (9T4J2) [NBP3-33229] - Western blot analysis of various lysates using CTP synthase Rabbit mAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

Western Blot: CTP synthase Antibody (9T4J2) [NBP3-33229] - Western blot analysis of various lysates using CTP synthase Rabbit mAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

Immunoprecipitation: CTP synthase Antibody (9T4J2) [NBP3-33229] - Immunoprecipitation of CTP synthase from 300 ug extracts of HeLa cells was performed using 0.5 ug of CTP synthase Rabbit mAb . Rabbit Control IgG was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using CTP synthase Rabbit mAb at a dilution of 1:500.

Immunoprecipitation: CTP synthase Antibody (9T4J2) [CTP synthase] - Immunoprecipitation of CTP synthase from 300 ug extracts of HeLa cells was performed using 0.5 ug of CTP synthase Rabbit mAb . Rabbit Control IgG was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using CTP synthase Rabbit mAb at a dilution of 1:500.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 9T4J2
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

CTP synthase Antibody (9T4J2) Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CTP synthase (P17812).
  
  Sequence:
  SVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCS
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CTPS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 67 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CTP synthase Antibody (9T4J2)

• CTP Synthase 1
• CTP synthase
• CTP synthetase 1
• CTPS1
• cytidine 5-prime triphosphate synthetase
• cytidine 5'-triphosphate synthetase
• EC 6.3.4.2
• GATD5
• IMD24
• UTP--ammonia ligase 1

Background

The catalytic conversion of UTP to CTP is accomplished by the enzyme cytidine-5-prime-triphosphate synthetase. The enzyme is important in the biosynthesis of phospholipids and nucleic acids, and plays a key role in cell growth, development, and tumorigenesis. The region to which the CTPS gene has been mapped is the location of breakpoints involved in several tumor types

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CTPS1