Ctip1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Ctip1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Ctip1
  
  

  Source: E. coli

  Amino Acid Sequence: HENSSRGAVVGVGDESRALPDVMQGMVLSSMQHFSEAFHQVLGEKHKRGHLAEAEGHRDTCDEDSVAGESDRIDDGTVNGRGC

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: BCL11A
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17030.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Ctip1 Recombinant Protein Antigen

• B-cell CLL/lymphoma 11A (zinc finger protein) isoform 2
• B-cell CLL/lymphoma 11A (zinc finger protein)
• B-cell CLL/lymphoma 11A
• B-cell lymphoma/leukemia 11A
• BCL11A B-cell CLL/lymphoma 11A (zinc finger protein) isoform 1
• BCL-11A
• BCL11A-S
• BCL11A-XL
• C2H2-type zinc finger protein
• COUP-TF-interacting protein 1
• CTIP1ecotropic viral integration site 9
• ecotropic viral integration site 9 homolog
• Ecotropic viral integration site 9 protein homolog
• EVI-9
• EVI9FLJ34997
• HBFQTL5
• KIAA1809BCL11A-L
• Zinc finger protein 856
• ZNF856FLJ10173

Background

The Ctip1 gene encodes a C2H2 type zinc-finger protein by its similarity to the mouse Bcl11a/Evi9 protein. The corresponding mouse gene is a common site of retroviral integration in myeloid leukemia, and may function as a leukemia disease gene, in part, throug

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: BCL11A