Recombinant Human Ctip1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Ctip1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 88 of Human BCL11A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQCNGSLCLEKAVDKPPSPS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
BCL11A
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Ctip1 Protein

  • B-cell CLL/lymphoma 11A (zinc finger protein) isoform 2
  • B-cell CLL/lymphoma 11A (zinc finger protein)
  • B-cell CLL/lymphoma 11A
  • B-cell lymphoma/leukemia 11A
  • BCL11A B-cell CLL/lymphoma 11A (zinc finger protein) isoform 1
  • BCL-11A
  • BCL11A-S
  • BCL11A-XL
  • C2H2-type zinc finger protein
  • COUP-TF-interacting protein 1
  • CTIP1ecotropic viral integration site 9
  • ecotropic viral integration site 9 homolog
  • Ecotropic viral integration site 9 protein homolog
  • EVI-9
  • EVI9FLJ34997
  • HBFQTL5
  • KIAA1809BCL11A-L
  • Zinc finger protein 856
  • ZNF856FLJ10173

Background

BCL11A - B-cell CLL/lymphoma 11A (zinc finger protein)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2600
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14081
Species: Hu
Applications: IHC, IHC-P
NBP2-37380
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP1-42827
Species: Hu, Mu, Rt, Ch, Fi, Re, Xp
Applications: WB, ICC/IF, IHC, IHC-Fr
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
MAB17791
Species: Hu, Mu
Applications: WB
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-31369
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-80306
Species: Hu
Applications: WB, IHC, IHC-P
AF844
Species: Mu
Applications: WB, Block
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
PP-H6506-00
Species: Hu
Applications: WB, IP, DirELISA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00053335-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Ctip1 Partial Recombinant Protein (H00053335-Q01) (0)

There are no publications for Ctip1 Partial Recombinant Protein (H00053335-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ctip1 Partial Recombinant Protein (H00053335-Q01) (0)

There are no reviews for Ctip1 Partial Recombinant Protein (H00053335-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ctip1 Partial Recombinant Protein (H00053335-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ctip1 Products

Bioinformatics Tool for Ctip1 Partial Recombinant Protein (H00053335-Q01)

Discover related pathways, diseases and genes to Ctip1 Partial Recombinant Protein (H00053335-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ctip1 Partial Recombinant Protein (H00053335-Q01)

Discover more about diseases related to Ctip1 Partial Recombinant Protein (H00053335-Q01).
 

Pathways for Ctip1 Partial Recombinant Protein (H00053335-Q01)

View related products by pathway.

PTMs for Ctip1 Partial Recombinant Protein (H00053335-Q01)

Learn more about PTMs related to Ctip1 Partial Recombinant Protein (H00053335-Q01).
 

Research Areas for Ctip1 Partial Recombinant Protein (H00053335-Q01)

Find related products by research area.

Blogs on Ctip1

There are no specific blogs for Ctip1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335
Ctip1 Antibody
NB600-261

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Ctip1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BCL11A