Ctip1 Antibody (3D9) - Azide and BSA Free Summary
| Immunogen |
BCL11A (NP_060484, 1 a.a. ~ 88 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQCNGSLCLEKAVDKPPSPS |
| Specificity |
BCL11A - B-cell CLL/lymphoma 11A (zinc finger protein) (3D9) |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
BCL11A |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1:500
|
| Application Notes |
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Ctip1 Antibody (3D9) - Azide and BSA Free
Background
This gene encodes a C2H2 type zinc-finger protein by its similarity to the mouse Bcl11a/Evi9 protein. The corresponding mouse gene is a common site of retroviral integration in myeloid leukemia, and may function as a leukemia disease gene, in part, through its interaction with BCL6. During hematopoietic cell differentiation, this gene is down-regulated. It is possibly involved in lymphoma pathogenesis since translocations associated with B-cell malignancies also deregulates its expression. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Ch, Fi, Hu, Pm, Mu, Rt, Re, Xp
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Ch, Mu
Applications: ELISA, IHC, Single-Cell Western, WB
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Av, Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Mu
Applications: Block, IHC, WB
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: DirELISA, IP, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Publications for Ctip1 Antibody (H00053335-M03) (0)
There are no publications for Ctip1 Antibody (H00053335-M03).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Ctip1 Antibody (H00053335-M03) (0)
There are no reviews for Ctip1 Antibody (H00053335-M03).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Ctip1 Antibody (H00053335-M03) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Ctip1 Products
Research Areas for Ctip1 Antibody (H00053335-M03)
Find related products by research area.
|
Blogs on Ctip1