Ctip1 Antibody (3D9) - Azide and BSA Free

Western Blot: Ctip1 Antibody (3D9) [H00053335-M03] - Analysis of BCL11A expression in transfected 293T cell line by BCL11A monoclonal antibody (M03), clone 3D9. Lane 1: BCL11A transfected lysatE (26.865 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: Ctip1 Antibody (3D9) [H00053335-M03] - Analysis of monoclonal antibody to BCL11A on HeLa cell. Antibody concentration 10 ug/ml

Immunohistochemistry-Paraffin: Ctip1 Antibody (3D9) [H00053335-M03] - Analysis of monoclonal antibody to BCL11A on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml

ELISA: Ctip1 Antibody (3D9) [H00053335-M03] - Detection limit for recombinant GST tagged BCL11A is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 3D9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Ctip1 Antibody (3D9) - Azide and BSA Free Summary

• Immunogen: BCL11A (NP_060484, 1 a.a. ~ 88 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQCNGSLCLEKAVDKPPSPS
• Specificity: BCL11A - B-cell CLL/lymphoma 11A (zinc finger protein) (3D9)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: BCL11A
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Ctip1 Antibody (3D9) - Azide and BSA Free

• B-cell CLL/lymphoma 11A (zinc finger protein) isoform 2
• B-cell CLL/lymphoma 11A (zinc finger protein)
• B-cell CLL/lymphoma 11A
• B-cell lymphoma/leukemia 11A
• BCL11A B-cell CLL/lymphoma 11A (zinc finger protein) isoform 1
• BCL-11A
• BCL11A-S
• BCL11A-XL
• C2H2-type zinc finger protein
• COUP-TF-interacting protein 1
• CTIP1ecotropic viral integration site 9
• ecotropic viral integration site 9 homolog
• Ecotropic viral integration site 9 protein homolog
• EVI-9
• EVI9FLJ34997
• HBFQTL5
• KIAA1809BCL11A-L
• Zinc finger protein 856
• ZNF856FLJ10173

Background

This gene encodes a C2H2 type zinc-finger protein by its similarity to the mouse Bcl11a/Evi9 protein. The corresponding mouse gene is a common site of retroviral integration in myeloid leukemia, and may function as a leukemia disease gene, in part, through its interaction with BCL6. During hematopoietic cell differentiation, this gene is down-regulated. It is possibly involved in lymphoma pathogenesis since translocations associated with B-cell malignancies also deregulates its expression. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BCL11A
• Entrez:
  • 53335(Human)
• Uniprot:
  • NP_060484(Human)