CTDSPL Antibody

Images

 
Western Blot: CTDSPL Antibody [NBP1-53169] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
Immunohistochemistry-Paraffin: CTDSPL Antibody [NBP1-53169] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Western Blot: CTDSPL Antibody [NBP1-53169] - DLD1 cell lysate, Antibody Titration: 0.2-1 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CTDSPL Antibody Summary

Immunogen
Synthetic peptides corresponding to CTDSPL(CTD (carboxy-terminal domain) small phosphatase-like) The peptide sequence was selected from the N terminal of CTDSPL. Peptide sequence CCFRDYNVEAPPPSSPSVLPPLVEENGGLQKPPAKYLLPEVTVLDYGKKC.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CTDSPL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against CTDSPL and was validated on Western Blot and immunohistochemistry-P

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CTDSPL Antibody

  • C3orf8
  • Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 3
  • CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) smallphosphatase-like
  • CTD small phosphatase-like protein
  • CTDSP-like
  • EC 3.1.3
  • HYA22
  • NIF1
  • NIFL
  • NIF-like protein
  • NLI-interacting factor 1
  • Nuclear LIM interactor-interacting factor 1
  • Protein YA22
  • PSR1
  • RB protein serine phosphatase from chromosome 3
  • RBSP3EC 3.1.3.16
  • SCP3chromosome 3 open reading frame 8
  • Small CTD phosphatase 3
  • Small C-terminal domain phosphatase 3
  • YA22

Background

CTDSPL may function as a phosphatase involved in the regulation of cell growth and differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-232
Species: Mu, Rt, Po, Bv, Ch, Fe, Pa
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
AF3059
Species: Mu
Applications: WB, Simple Western, ICC
NB300-229
Species: Mu, Rt, Ma, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-03456
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87127
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56552
Species: Hu
Applications: WB
AF3827
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP1-32283
Species: Hu, Mu, Rt
Applications: WB
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
MAB2476
Species: Hu
Applications: WB, IHC
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-55940
Species: Hu
Applications: ICC/IF
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
AF2030
Species: Hu
Applications: WB, IHC
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-181
Species: Hu, Mu
Applications: WB, IP
NBP1-85958
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-29997
Species: Hu
Applications: WB, ICC/IF, IHC-P

Publications for CTDSPL Antibody (NBP1-53169) (0)

There are no publications for CTDSPL Antibody (NBP1-53169).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CTDSPL Antibody (NBP1-53169) (0)

There are no reviews for CTDSPL Antibody (NBP1-53169). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CTDSPL Antibody (NBP1-53169) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CTDSPL Products

Bioinformatics Tool for CTDSPL Antibody (NBP1-53169)

Discover related pathways, diseases and genes to CTDSPL Antibody (NBP1-53169). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CTDSPL Antibody (NBP1-53169)

Discover more about diseases related to CTDSPL Antibody (NBP1-53169).
 

Pathways for CTDSPL Antibody (NBP1-53169)

View related products by pathway.

PTMs for CTDSPL Antibody (NBP1-53169)

Learn more about PTMs related to CTDSPL Antibody (NBP1-53169).

Blogs on CTDSPL

There are no specific blogs for CTDSPL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CTDSPL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTDSPL
Uniprot