CTDSP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CTDSP1 Antibody [NBP2-57578] - Staining of human cell line Hep G2 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CTDSP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EALPAHSGAPLLVEENGAIPKQTPVQYLLPEAKAQDSDKICVV
Specificity
Specificity of human CTDSP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CTDSP1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CTDSP1 Recombinant Protein Antigen (NBP2-57578PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CTDSP1 Antibody

  • carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1
  • CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) smallphosphatase 1
  • NIF3
  • NLI-IF
  • NLIIFEC 3.1.3.16
  • NLI-interacting factor 3
  • SCP1Nuclear LIM interactor-interacting factor 3
  • Small CTD phosphatase 1
  • Small C-terminal domain phosphatase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-232
Species: Hu, Mu, Rt, Po, Bv, Ch, Fe, Pa
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB300-229
Species: Mu, Rt, Ch, Ma, Pm, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-53169
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-32283
Species: Hu, Mu, Rt
Applications: WB
NBP1-85958
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-94045
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00009150-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB600-507
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, PEP-ELISA, KD
NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
MAB8400
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-47714
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-93444
Species: Hu
Applications: WB, PEP-ELISA
NB100-757
Species: Hu
Applications: WB, IHC, IHC-P, ChIP
NBP1-85533
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-02161
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB100-56443
Species: Hu, Mu, Rt
Applications: WB

Publications for CTDSP1 Antibody (NBP2-57578) (0)

There are no publications for CTDSP1 Antibody (NBP2-57578).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CTDSP1 Antibody (NBP2-57578) (0)

There are no reviews for CTDSP1 Antibody (NBP2-57578). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CTDSP1 Antibody (NBP2-57578) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CTDSP1 Products

Bioinformatics Tool for CTDSP1 Antibody (NBP2-57578)

Discover related pathways, diseases and genes to CTDSP1 Antibody (NBP2-57578). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CTDSP1 Antibody (NBP2-57578)

Discover more about diseases related to CTDSP1 Antibody (NBP2-57578).
 

Pathways for CTDSP1 Antibody (NBP2-57578)

View related products by pathway.

PTMs for CTDSP1 Antibody (NBP2-57578)

Learn more about PTMs related to CTDSP1 Antibody (NBP2-57578).

Blogs on CTDSP1

There are no specific blogs for CTDSP1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CTDSP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTDSP1