CSH2 Antibody

Images

 
Western Blot: CSH2 Antibody [NBP1-57026] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CSH2 Antibody Summary

Immunogen
Synthetic peptides corresponding to CSH2 (chorionic somatomammotropin hormone 2) The peptide sequence was selected from the middle region of CSH2. Peptide sequence LFDHAMLQAHRAHQLAIDTYQEFRLEDGSRRTGQILKQTYSKFDTNSHNH.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CSH2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CSH2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CSH2 Antibody

  • chorionic somatomammotropin B
  • chorionic somatomammotropin hormone 2
  • CS-2
  • CSBChoriomammotropin
  • hCS-B
  • Lactogen
  • PL
  • Placental lactogen

Background

The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, while the ratio of 1 to 2 increases by term. Structural and expression differences provide avenues for developmental regulation and tissue specificity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1445
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NBP2-46376
Species: Hu
Applications: WB, IHC
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
MAB1417
Species: Hu, Mu, Bv
Applications: CyTOF-ready, ICC, ICFlow
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90927
Species: Hu
Applications: WB, IHC, IHC-P
H00002074-Q01
Species: Hu
NBP2-38958
Species: Hu
Applications: IHC, IHC-P
NBP2-45519
Species: Hu
Applications: WB, IHC
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP2-34183
Species: Hu
Applications: IHC, IHC-P
H00093659-P01
Species: Hu
NBP1-47801
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-57026
Species: Hu
Applications: WB

Publications for CSH2 Antibody (NBP1-57026) (0)

There are no publications for CSH2 Antibody (NBP1-57026).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CSH2 Antibody (NBP1-57026) (0)

There are no reviews for CSH2 Antibody (NBP1-57026). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CSH2 Antibody (NBP1-57026) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CSH2 Products

Bioinformatics Tool for CSH2 Antibody (NBP1-57026)

Discover related pathways, diseases and genes to CSH2 Antibody (NBP1-57026). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CSH2 Antibody (NBP1-57026)

Discover more about diseases related to CSH2 Antibody (NBP1-57026).
 

Pathways for CSH2 Antibody (NBP1-57026)

View related products by pathway.

PTMs for CSH2 Antibody (NBP1-57026)

Learn more about PTMs related to CSH2 Antibody (NBP1-57026).

Blogs on CSH2

There are no specific blogs for CSH2, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CSH2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CSH2
Uniprot
Novus 100% Guarantee