CROT Antibody [Allophycocyanin]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Allophycocyanin

CROT Antibody [Allophycocyanin] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-87 of human CROT (NP_001230674.1).
  
  Sequence:
  MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKLLERAKGKRNWVFVVIIE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CROT
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoprecipitation
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Alternate Names for CROT Antibody [Allophycocyanin]

• carnitine O-octanoyltransferase
• COTperoxisomal carnitine O-octanoyltransferase
• EC 2.3.1
• EC 2.3.1.137
• peroxisomal carnitine acyltransferase
• peroxisomal carnitine octanoyltransferase

Background

Carnitine octanoyltransferase (EC 2.3.1.137) is a carnitine acyltransferase that catalyzes the reversible transfer of fatty acyl groups between CoA and carnitine. This provides a crucial step in the transport of medium- and long-chain acyl-CoA out of the mammalian peroxisome to the cytosol and mitochondria. See also CRAT (MIM 600184). Van der Leij et al. (2000) [PubMed 11001805] reviewed the function, structural features, and phylogenetics of human carnitine acyltransferase genes, including CROT.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CROT