CRMP1 Antibody (2B6)

Images

 
Western Blot: CRMP1 Antibody (2B6) [H00001400-M50] - CRMP1 monoclonal antibody (M50), clone 2B6. Western Blot analysis of CRMP1 expression in IMR-32 ( Cat # L008V1 ).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2B6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CRMP1 Antibody (2B6) Summary

Immunogen
CRMP1 (NP_001014809.1, 221 a.a. - 310 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVIL
Specificity
CRMP1 - collapsin response mediator protein 1 (2B6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CRMP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CRMP1 Antibody (2B6)

  • collapsin response mediator protein 1DRP1
  • CRMP-1
  • dihydropyrimidinase-like 1
  • dihydropyrimidinase-related protein 1
  • DPYSL1DRP-1dihydropyrimidinase related protein-1
  • ULIP3
  • ULIP-3
  • Unc-33-like phosphoprotein 3

Background

This gene encodes a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The encoded protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-55288
Species: Hu, Mu, Rt, Fi, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB100-56646
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
H00009927-M03
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-51841
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-55290
Species: Hu, Mu, Rt, Po, Ch
Applications: WB, Simple Western, IHC, IHC-P
NB100-2357
Species: Hu, Mu, Pm
Applications: WB, IHC-P, IP
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85448
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-01512
Species: Hu, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-85447
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00007402-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB110-60491
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, Flow, IHC, IHC-Fr, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
BC100-494
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IHC-P, IP, PEP-ELISA
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56311
Species: Hu
Applications: WB, ICC/IF, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CRMP1 Antibody (H00001400-M50) (0)

There are no publications for CRMP1 Antibody (H00001400-M50).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRMP1 Antibody (H00001400-M50) (0)

There are no reviews for CRMP1 Antibody (H00001400-M50). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CRMP1 Antibody (H00001400-M50) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CRMP1 Products

Bioinformatics Tool for CRMP1 Antibody (H00001400-M50)

Discover related pathways, diseases and genes to CRMP1 Antibody (H00001400-M50). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRMP1 Antibody (H00001400-M50)

Discover more about diseases related to CRMP1 Antibody (H00001400-M50).
 

Pathways for CRMP1 Antibody (H00001400-M50)

View related products by pathway.

PTMs for CRMP1 Antibody (H00001400-M50)

Learn more about PTMs related to CRMP1 Antibody (H00001400-M50).
 

Research Areas for CRMP1 Antibody (H00001400-M50)

Find related products by research area.

Blogs on CRMP1

There are no specific blogs for CRMP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRMP1 Antibody (2B6) and receive a gift card or discount.

Bioinformatics

Gene Symbol CRMP1
Entrez
Uniprot